SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002483 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002483
Domain Number 1 Region: 399-484
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 2526-2619
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 3010-3108
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1e-17
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 4 Region: 2609-2696
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 2426-2516
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 2047-2129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000942
Family I set domains 0.023
Further Details:      
 
Domain Number 7 Region: 2243-2324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000168
Family I set domains 0.043
Further Details:      
 
Domain Number 8 Region: 1557-1609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 322-359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 10 Region: 281-318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 1153-1205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 12 Region: 191-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 818-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 14 Region: 2906-2952
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000014
Family I set domains 0.018
Further Details:      
 
Domain Number 15 Region: 758-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 16 Region: 2384-2431
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000264
Family I set domains 0.042
Further Details:      
 
Domain Number 17 Region: 1212-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002483
Domain Number - Region: 2190-2232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000131
Family I set domains 0.061
Further Details:      
 
Domain Number - Region: 879-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 1269-1316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000285
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number - Region: 2860-2887
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00247
Family I set domains 0.055
Further Details:      
 
Domain Number - Region: 720-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 1117-1155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0187
Family Laminin-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002483   Gene: ENSEEUG00000002640   Transcript: ENSEEUT00000002709
Sequence length 3108
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4566:88:275394:-1 gene:ENSEEUG00000002640 transcript:ENSEEUT00000002709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRAAGALLLALLLLHGRLLAVAYHDWSLFNNEEKVLGGRTGKTFPDYSDDEDLLGDDA
EASGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXELDGWVFVELDVGSEGNSDGAQIQDVLHKVVSSGSIASYITSPQ
GFQFRRLGTVLQYPRVCTENEFACHSHNECVPLEYRCDRRPDCRDMSDELNCEEPVQELS
PTAPPLMEVPLFFTPRPEATTTEHLPSTLPPWHLPPSAAGPLNCGPQEAACHSGHCIPKD
YICDGQEDCKDGSDELDCGPAPPCEPNEFPCGNGHCALKLWHCDGDYDCEDHTDEANCPS
AQPEYVGPTKFRCVSTSTCIPSFCDEESDCPDSDEICMPPQVVIPPQELIQVSRGQTVTF
TCVATGVPTPIINWRLNWGHIPSHPRVTMTSEGGRGTLTIRDVKEADQGAYTCEAMNARG
MVFGIPDGVLELIPQQGPCPDGHFFLEDSASCLPCFCFGVTNMCQSSRRFRDQIRLRFDQ
PDDFKGVNVTMPAQPGMLPLSSTQLQIDTARQEFQLVDLSRRFLVHDXXXXXXXXXXXXX
VDSYGGSLNYKVYYDLARGMLEPVQRPDVVLVGAGYRLHSRGHSPTQPGTLNQRQVHFSE
EHWVHESGQPVQRAEMLQVLHNLEAVLIQTVYNAKMASVGLSDIAMDTTVTYATSHGHAH
SVEECRCPSGYSGLSCESCAAHFTRVPEGPYLGTCSDCNCNGHASSCDPVYGHCLNCQHN
TERPKCNKCKAGYFGDATKATAIACRPCPCPYIDASRRFSDTCFLDTDGQATCDACAVGY
TGRRCESCAPGYEGNPIQPGGKCRPANQELVRCDERGSTGNSGEACHCKSNVVGRLCNEC
VPGSFHLSTHNPDGCLKCFCMGVSRQCTSTSWTRAQVLGASEEPSKFSLTNAAGTHTTSE
GISSPRPGELVFSSFHNLLSGPYFWSLPTIFRGDKVTSYGGELRFRVTQQPQADSPPLPA
QPLVVLQGNGIVLEHHTSQELPPGQPRAFAVPFREHAWQRPDGQPATREHLLMALAGVDT
LLIQASYTQRPDESRVSDISMDVAVPEDSGQDPALEVEQCTCPPGYRGPSCQDCDTGYTR
TPSGLYLGTCELCSCHGHTEVCEPETGACMGCQHHTVGLRCEQCQPGYYGDAQRGTPQDC
QPCPCYGPPASDQTTHTCFLDTDSHPTCDACSPGHSGRHCERCAPGYYGNPRHGQPCRRD
DQTQGPIGCVCDPQGSISSQCDTTGQCQCKAQVEGLTCSHCRPHHFYLSARNPDGCLPCF
CMGITQQCSSSSYTRQLISTRFAPGDFQGFALVNPQHNSRLTGDFTVEPMSEGAQLSFGN
FAHLGHESFYWQLPEKYQGDKVAAYGGRLRYTLSYTAGVQSSPLSDPDVQITGNNIMLVT
TQPTPPGPERKSYEIIFREEFWRRMDGQPATREHLLMALADLDELLVRATFSSVPQAASI
SSVSMEVAQPGFSDGPRALEVEECRCPLGYIGLSCQDCGPGYTRTGSGLYLGHCELCECN
GHSDLCHPETGTCSQCQHNATGEFCELCSPGYYGDATAGTPEDCQPCACPLTNPENMFSR
TCESLGAGGYRCTACEPGYTGQYCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP
GGAGNIRIESSSSQVNEGQTLDLHCMVPGQTHAQVTWHKRGGSLPARHQAHGSRLRLYQL
SLADTGEYVCRVVSSSGTLEASILVTVEASGSSATPXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVHGPLLRLNQVSPADSGEYSCQMKSNSGTLEAS
VLVTIEASNPSPMPAPGLAQPIYIEGSSSHVAEGQTLDLNCVVPGQDHAQVTWQKRGGSL
PARHQIHSSRLRIPHVSPADSGEYVCRVAGSESPEQEASFTVTIPPSAGSSYRLRSPVIX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSPISPNGSVIIIVGARPSN
HGAYRCVASNAYGVAQSIVSLSVHGPPVVSVLPEGPIRVKVGKDITLECVSAGEPRSSTR
WTRIGTSNSLEQRTYGVVDSHTVLQISSAKPSDAGTYICLAQNALGTTQKQVEVIVDTGI
VAPGMPQVQVEEVELTVEAGHTATLRCSATGSPMPTIHWSKLRSPLPWQHRLEGNTLIIP
QVAQQDSGQYICNATNPVGHVEATVVLHVESPPYATTIPEHTSVHAGEMVQLQCLAHGTP
PLTFQWSRVGGNLPTRAAIRNNLLHLEHTVPEDSGHYRCQVTNKVGTAEAFAEVLIQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEDAGSYSCVVTNTAGSRHR
DVLLLVQXXXXXXXXXXXXXXXXXAASLPCVTSGVPTPTITWTKLQRSKDGTLSSPRHLS
QDAGTYVCTATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLLYNGQKWI
PGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLFRSLTQG
SMIVGGFDPINGTSQGKFQGLDLNEELYLGGYPDYSAIPKVGLNSGFV
Download sequence
Identical sequences ENSEEUP00000002483 ENSEEUP00000002483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]