SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002484 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002484
Domain Number 1 Region: 534-760
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.59e-63
Family Oxysterol-binding protein 0.00014
Further Details:      
 
Domain Number 2 Region: 17-123
Classification Level Classification E-value
Superfamily PH domain-like 5.91e-24
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002484   Gene: ENSEEUG00000002707   Transcript: ENSEEUT00000002710
Sequence length 766
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2748:7436:157712:1 gene:ENSEEUG00000002707 transcript:ENSEEUT00000002710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYRRVTSGRLLSLAALKMASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKM
MRGSRRGCVRLRGAVIGIDDEDDSTFTITVDQKTFHFQARDADEREKWIHALEETILRHT
LQLQISTTLAFFQSSGISPVLEFSKIIGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKL
FDDKLQNCKDDEQRKKIETLKETTNSMVESIKHCIVLLQIAKSTINPVDAIYQPSPLEPV
INTMPSQTVLPPETAQLCKSEQRPSSLPVGPVLASLGHHQTPTPNSTGSGHSPPTSSLTS
PSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAFYAEC
FNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYDEHYILTFPNGYGRQVSILTVPW
VELGGECNINCSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKSFCSIEGEWNGVMY
AKYATGENAVFVDTKKLPIIKKKVRKLEDQNEYESRCLWKDVTFNLKIRDIDAATEAKHR
LEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH
Download sequence
Identical sequences ENSEEUP00000002484 ENSEEUP00000002484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]