SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002505 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002505
Domain Number 1 Region: 74-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.6e-28
Family BAR domain 0.0000282
Further Details:      
 
Domain Number 2 Region: 469-599
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-19
Family Phosphotyrosine-binding domain (PTB) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002505   Gene: ENSEEUG00000002723   Transcript: ENSEEUT00000002735
Sequence length 662
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3985:93358:195490:-1 gene:ENSEEUG00000002723 transcript:ENSEEUT00000002735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALQDSPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXNFALGKGDEEVISTLHYFSNVVDKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVSTLKDLFGIASNEHDLSMAKYSRLPKKKENEKAKSEVVKEVAAARRKQHLSSLQ
YYCALNALQYRKRVAMMEPMIGFAHGQINFFKKGAEMFSQSMDSFLSSVTDMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYTPDFDVSTPEANRNLIQKAGYLNLRXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXAVAIKLNQTALQAVTPITSFGKKQESPCPSQNLKSP
ETENDKVVPKAAVSIPEADQLIAPGTPIQFDIVLPASEFLDQNRVGRRTNPFGESEDETF
PEAEDSLLQQMFIVRFLGSMAVKTDNTTEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQ
TLRLIDPQTQVTRANFELTSVTQFAAHQENKRLVGFVVRMPESTGGESLSTYVFESNAEG
EKXXXXXXXXXXXXXXXXDPEALAQLMLSIPLTSDGKYVLLNDQPDDNDGTSSGNRGTES
EA
Download sequence
Identical sequences ENSEEUP00000002505 ENSEEUP00000002505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]