SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002528 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002528
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.01e-24
Family Pyk2-associated protein beta ARF-GAP domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002528
Domain Number - Region: 415-471
Classification Level Classification E-value
Superfamily OmpH-like 0.0536
Family OmpH-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002528   Gene: ENSEEUG00000002753   Transcript: ENSEEUT00000002761
Sequence length 740
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4350:146:35645:-1 gene:ENSEEUG00000002753 transcript:ENSEEUT00000002761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSWASVNRGTFICDECCGVHRSLGRHISQVRHLRHTPWPPTLLQMVETLYNNGANSIWEH
SLLDPASLMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKNGQHFLIPQMADSSLD
LSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLATQNHSTLVTETTVVPFLP
VNPEYSSTRNQAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVELILKAVSSQ
HSVESQDNDQPDYDSVASDEDADLEATAGKASRQKSLDSDLSDGAVTVQELMEVKNALVA
SEAKIQQLMKVNDNLSDELRTMQKKLQTLQSENSNLRKQSTASVYQVQTASEYPDTCKHS
SLKRRPSARGSRPMSMYETGSGHKPYLPLGDAERPEESRTRLPPFPAHIGRSAFVTSSSS
LPSFPSTLSWSRDESTRRASRLEKQNSTPESDYDNTPNDRDADDTGPGKKGRQSSTAWQG
DGSVPDTAEPHMAPSPVLPSTEDVIRKTEQITKNIQELLRAAQENKHDSYSPCSERIHDA
VTEMAALFPKKPKSDTARTSLRLLTSSAYRLQSECKKTLPGDLGPPADIQLVTQQVIQCA
YDIAKAAKQLVTITTKENSS
Download sequence
Identical sequences ENSEEUP00000002528 ENSEEUP00000002528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]