SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002628 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002628
Domain Number 1 Region: 14-128
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000246
Family Pleckstrin-homology domain (PH domain) 0.00000114
Further Details:      
 
Domain Number 2 Region: 298-328
Classification Level Classification E-value
Superfamily SH3-domain 0.0000227
Family SH3-domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002628   Gene: ENSEEUG00000002872   Transcript: ENSEEUT00000002870
Sequence length 329
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_44:14646:54967:-1 gene:ENSEEUG00000002872 transcript:ENSEEUT00000002870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNPSSTSCPNPLPEEIRNLLADVETFVADILRGENLSKKAKEKRESLIKKIKDVKSIYI
QEFQDKGDTEDGDEYDDPFAGPADTISLASERYDKDDEAPSDGNQFPPIAAQDLPFVLKA
GYLEKRRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEEEDSAPVKVEAQRKTSQDSVHHTTGDKSTDYAN
FNQGLWDCTGSLSDELSFKRGDVIYILSR
Download sequence
Identical sequences ENSEEUP00000002628 ENSEEUP00000002628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]