SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002631 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002631
Domain Number 1 Region: 12-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000283
Family SAM (sterile alpha motif) domain 0.051
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002631
Domain Number - Region: 1040-1091
Classification Level Classification E-value
Superfamily TPR-like 0.0101
Family Tetratricopeptide repeat (TPR) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002631   Gene: ENSEEUG00000002873   Transcript: ENSEEUT00000002873
Sequence length 1548
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8766:48007:52945:-1 gene:ENSEEUG00000002873 transcript:ENSEEUT00000002873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEQVNLPEMTQDWTKEHVKQWVTNDLQIDEKYGQILLCEEVTGRVLQVLTEKDLIEMGL
PRGPALLIKRKFKSLNNLSSKNSNQNSGQLDHAEPSKKEHQRKHKTENTLSNNDHDVREI
QNAKAQELAATGKNAQDEVGITEEKKKKRKIVQSTCMPYPFDQFHASHHYTEHYILQPET
GPLNLIDPIHEFKALTNTETATEKDIKMKFSNEVFRFASACMNSRTNGTIHFGVLDKPHG
EIVGVKVRSKDAFIDHFNLMIKQYFEESEIKEAKKCIREPRFVEVLLQNYTPSDRFVIEV
DVIPKHSICKEKYFYTNMQSYKNDTWKQNQESSLFVRDGASSVDILANGKQRDKNFKTFL
QNLKSLAEDRKDAEKEHEMKANKKECEGQKLIKLLIGNQDSLDNSYYNWYILVTNKCNPS
QRLDFLKEIKWFAVLEFDPESESKGVAKTYRESRVANLHPNQYAEKTTTMREKISSLSLW
EPRQWQEERASGRAKLNYFLTDENIMTRGKFLVVFLLLSPVESPGDPLIEPFCTFFKVLN
GMQNIMCICVTPQIYQRWKDLLQTRFVMSDELTNHSISTLSLELLNSTILKLKSVTQSSK
RFLPSRGSSSVILEKKEEDFLTALEILCENECGDTDIEKDECKFEEFRKSKEEHFYRGGK
VSWWNFYFSSENYSSFIKRDRYEELRSLIEDWAESPKPVFAKIINLYHHPGCGGTTLAMN
VLWDFRKKFRCAVLKNKATDFAEIGEQVTNLIAYKASSYQDYIPVLLLVDDFEEQENVFV
LQNAIHSILAEKDLRYEKTLVIILNCMRSQNPDESAKLDDSIVLKYQLSPKEKRAFSTKL
KEIEKQHKNFENFYSFMIMKSNFDEMYIENVVGNILKGQDGDSKETQLISFLALLNSYVT
DSTISVPQCEIFLGITYIKTPWKQESLEDKMGTYSTLLINADIAEYGFPGVRIIHPLIAI
FCLKELKKSYHLDKSRIALKLLSENLFYNSGIGKDKFQHDVQTLLLTRQRKGYGGETDMF
SPLIDLQXXXXXXXXXXXSNRFPQNAFICQALARLYIHERNFNTALDWAYQAKRKAPKNS
YISDTLGQVYKNEVKWWLDENRSCKEITIDDLMHCLDAAEKASRAFKTSQEQTDKKDSET
EAWSTQKSLKRYEMYNTAGFLGEIEVGLYAIQILQLTPCFHKENKLSQRHTVEFLSGKGN
IPEHSKGKYYLAISKFTSHLRNLQSDLKRCFDFFADYMVFLKTRNTQKETAEIILSKKVS
RYFRQYIELFCHSDVGILQNKGSQLLQEEYYRKSLEAKRADRFSGLLEYLNPSHQETGNI
MENIVEEYAFLLQQNPNKRMIKEKQNFILANIILSCLKPNSKFIQPLDTLKKQLREVLQL
VEINRQYPDPYFLACLLFWPDNQELDQDSKLMEKYVSSLKKSFNRHYRLMCRSKQASTLF
YLGNRKGLNSLVHKAEIEQYISKVKNTNSFWQSGHVWKKEEVKGLLRRLNGRAEGKLILM
EYGTEEKIKIPVISVYSGPLRSGRNIQRVSFYLGFSMEGPLAYDIEVI
Download sequence
Identical sequences ENSEEUP00000002631 ENSEEUP00000002631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]