SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002652 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000002652
Domain Number - Region: 127-172
Classification Level Classification E-value
Superfamily EF-hand 0.014
Family Calmodulin-like 0.08
Further Details:      
 
Domain Number - Region: 179-299
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0442
Family RIO1-like kinases 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002652   Gene: ENSEEUG00000002906   Transcript: ENSEEUT00000002896
Sequence length 408
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3019:9780:26486:-1 gene:ENSEEUG00000002906 transcript:ENSEEUT00000002896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARFSYVRMKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCKKIICDKYKTGVIDGPACN
SLCVTETLYFGKCLSTKPNNQMYLGIWDNLPGVVKCQMEQALHLDFGTELEPRKEIVLFD
KPTRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADGDKDGQVSLGEAKSAWALL
QLNEFLLMVILQDKEHTPKLMGFCGDLYVMESVEYTSLYGISLPWVIELFIPSGFRRSMD
QLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNLGYNDKYDLKMVDMKKIVP
ETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQPNLKACQLLKDYLLRGAP
SEIREEIEKQLSCIALKVTANQMEMQHSLILNNLKTLLWKKISYTNDS
Download sequence
Identical sequences ENSEEUP00000002652 ENSEEUP00000002652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]