SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002703 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002703
Domain Number 1 Region: 268-373
Classification Level Classification E-value
Superfamily MIR domain 9.29e-24
Family MIR domain 0.0091
Further Details:      
 
Domain Number 2 Region: 1079-1206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-17
Family Galectin (animal S-lectin) 0.062
Further Details:      
 
Domain Number 3 Region: 2194-2264
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000131
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 4 Region: 659-782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000148
Family SPRY domain 0.064
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002703
Domain Number - Region: 158-206
Classification Level Classification E-value
Superfamily MIR domain 0.000968
Family MIR domain 0.034
Further Details:      
 
Domain Number - Region: 1432-1554
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0047
Family SPRY domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002703   Gene: ENSEEUG00000002816   Transcript: ENSEEUT00000002948
Sequence length 4952
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1745:7868:209389:1 gene:ENSEEUG00000002816 transcript:ENSEEUT00000002948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGGEGEDEVQFLRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQADASFMQTLWNMNPICSCCEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLV
VVDASKAHTKATSFCFRISKEKLDVGPKRDIEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDPKALRLGVLKKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVL
DVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRTNIFVGRAEGFKQYS
KYFEVMVDEVTPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARLVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLLALGCHVGMADEKAEDNLKKTKLPKTXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVDSQSRWDRVRIFRAEKSY
AVQSGRWYFEFEAVTTGEMRVGWARLELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQPGDVVGCMIDLTENNIIFTLNGEILMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEAVPLEHPHYEVARVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPSGLQPPSED
EARAAEPDSDYENLRRSAGGWGEVEGGKDGTIKEGTPGSTTQAGGEAQPTRVENEKDATT
EKSKKRGFLFKAKKVAMMTQPPATPTLPRLPREVVPMDNRDDPEIILNTTTYYYSVRIFA
GQEPSCVWAGWVTPDYHQHDMNFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGDFV
SPGQQGRISHTDFVIGCLVDLATGLMNFTVNGKESNTFYQVEPNTKLFPAVFVLPTNQNV
IQFELGKQKNIMPLSAAMFLSERKNSAPQCPPRLEMQMLMPVSWSRMPNHFLQVDTHRAG
ERLGWAVQCQDPLTMMALHIPEENRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSP
SIPLEALRDKALRMLGEAVRDGGQQARDPVGGSVEFQFVPVLKLVSTLLVMGVFGDEDVK
QILKMIEPEVFKEQEEEEEEGEEEEEDEEEKEEDEEEEAQEKEDEEKEEEEEEEETAEGE
KEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQGNQRGRY
GLLMKAFTMSAAETARRTREFRSPPQEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLQEL
VSHTVVRWAHEDFVQSELRMFSLHRQYDGLGELLRALPAYTISPSSMEDTMSLLECLGQI
RSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKE
IRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVID
NNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGEHYLDFLRFAVFVN
GESVEENANVVVRLLIRKPECFGPALRGEGGSGRLAAIKEAIRISEDPAQDGPGVRRDRR
REXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSM
LHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLK
LLTNHYERCWKYYCLPTGWANFGVTSEEELHLSRKLFWGIFDSLAHKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKEIYRWPIKESLKAMIAWEWT
IEKAREGEEEKTEKKKTRKISQNAQTYDPREGYNPQPPDLSGVTLSRELQAMAEQLAENY
HNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKSRDREKAQELLKFLQMNGYAVTRYVX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCYRTLCSIYSLGTTKN
PYVEKLRPALGECLACLAAAMPVAFLEPELNEYNACSVYTTKSPRERAXXXXXXSVEEMC
PDIPVLERLMADIGGLAESGARYMEMPHVIEITLPMLCSYLPRWWERGPEMSGAPPPCTA
VTSSHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHTHFIPTIGRLR
KRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKAGKKKEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLVEDYLYMAYA
DIMAKSCHLEEGGENGEGEEEEAEVSFEEKEMEKQRLLYQQARLHNRGAAEMVLQMISAC
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQ
TGNTNTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAXXXXXXXX
XXXXGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVM
LLSLLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
AENGEKEAPEPPPEPPKKTAAPSPPPKKEGGSAGLEFWNELEVQRVKFLNYLSRNFYTLR
FLALFLAFAINFILLFYKVSDSPPGEDDTEGSAAGDLSGAGSGSGSGWGSGAGEEAEGDE
DENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSFPSNYWDKFVKRKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFLYLSWYMVMSLLGH
YNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLLMTVGLLAVVVYLYTVVAXXXXXXXX
XXXXXXXXXXXXXXXXXXCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFF
VIVILLAIIQGLIIDAFGELRDQQEQVKEDME
Download sequence
Identical sequences ENSEEUP00000002703 ENSEEUP00000002703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]