SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002704 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000002704
Domain Number - Region: 130-179
Classification Level Classification E-value
Superfamily PH domain-like 0.00107
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002704   Gene: ENSEEUG00000002952   Transcript: ENSEEUT00000002949
Sequence length 202
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5369:11491:78155:-1 gene:ENSEEUG00000002952 transcript:ENSEEUT00000002949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTPTPLMKTRTHSGCKATYQGKIPNGM
QILSCCYETPVIKPCKNTLVRKHDFPPTLQEIDTYSQRVHLDHIAERMHMETLXXXXXXX
XXXXXXXXXXXFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKS
DGRIHRNSSSEEASQELESDDG
Download sequence
Identical sequences ENSEEUP00000002704 ENSEEUP00000002704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]