SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002753 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002753
Domain Number 1 Region: 3815-4015
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.05e-38
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 3332-3443
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-31
Family Cadherin 0.00056
Further Details:      
 
Domain Number 3 Region: 3226-3330
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-30
Family Cadherin 0.00077
Further Details:      
 
Domain Number 4 Region: 3122-3225
Classification Level Classification E-value
Superfamily Cadherin-like 6e-29
Family Cadherin 0.00048
Further Details:      
 
Domain Number 5 Region: 920-1023
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 1762-1882
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 3020-3128
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-26
Family Cadherin 0.00042
Further Details:      
 
Domain Number 8 Region: 815-926
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-25
Family Cadherin 0.0009
Further Details:      
 
Domain Number 9 Region: 1553-1661
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-25
Family Cadherin 0.00087
Further Details:      
 
Domain Number 10 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-24
Family Cadherin 0.0017
Further Details:      
 
Domain Number 11 Region: 709-813
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 12 Region: 3436-3540
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 13 Region: 456-557
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-21
Family Cadherin 0.00095
Further Details:      
 
Domain Number 14 Region: 1130-1211
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 15 Region: 2489-2599
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 16 Region: 1663-1784
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-20
Family Cadherin 0.0016
Further Details:      
 
Domain Number 17 Region: 2386-2486
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-20
Family Cadherin 0.0018
Further Details:      
 
Domain Number 18 Region: 2587-2697
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 19 Region: 1449-1551
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-17
Family Cadherin 0.0016
Further Details:      
 
Domain Number 20 Region: 561-662
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000371
Family Cadherin 0.002
Further Details:      
 
Domain Number 21 Region: 1870-1989
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000514
Family Cadherin 0.0034
Further Details:      
 
Domain Number 22 Region: 2703-2829
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000717
Family Cadherin 0.0035
Further Details:      
 
Domain Number 23 Region: 365-462
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000171
Family Cadherin 0.0019
Further Details:      
 
Domain Number 24 Region: 4130-4168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000863
Family EGF-type module 0.005
Further Details:      
 
Domain Number 25 Region: 2342-2393
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000157
Family Cadherin 0.0048
Further Details:      
 
Domain Number 26 Region: 3548-3634
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000104
Family Cadherin 0.0067
Further Details:      
 
Domain Number 27 Region: 4043-4167
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 28 Region: 1083-1136
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0064
Further Details:      
 
Domain Number 29 Region: 33-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000343
Family Cadherin 0.0074
Further Details:      
 
Domain Number 30 Region: 2986-3026
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000514
Family Cadherin 0.0098
Further Details:      
 
Domain Number 31 Region: 4017-4056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000137
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002753
Domain Number - Region: 245-353
Classification Level Classification E-value
Superfamily Cadherin-like 0.000314
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002753   Gene: ENSEEUG00000002956   Transcript: ENSEEUT00000002999
Sequence length 4591
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_996:4148:106282:-1 gene:ENSEEUG00000002956 transcript:ENSEEUT00000002999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHLTLLLLLLLLLQQFGDSGGSQTLEQIPMQFTHAQYNVTVHENSAAKTYVGHPIKMG
IYLTNPLWELRYKIVSGDNENLFKAEEYVFGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KAVEKNTNAEARTKVRVQVLDTNDLRPLFSPTSYSVFLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGAVVLTGRLDYTETKLYEMEILAVDRGMKLYGNSGISSM
AKLTVHVEQANECAPVITAVTLSPSELDKDPTYAIVSVDDCDQGANGEIASLSIVAGDFL
QQFRTVRSSPGSKEYKIKAINGIDWDNHPFGYNLTLQAKDKGVPPQFSSVKVIHVSSPQF
AGPVKFERDVYRAEISEFAPSDTPVVMVKATPTHSHLRYVFKSTPGRAKFSINHNTGLIS
ILEPIKRQQASHYELEVTTSDRKASTKVIVKVLSANSNPPEFSQTAYKASFDENVPIGTT
VMSVSAIDPDEGENGYVTYSIANLNRVPFVINHFTGAVSTSENLDYELMPRVYMLKIRAS
DWGLPYRREVEVHATVTLNNLNDNTPLFEKINCEGTIPRDLDVGEQITTVSAIDADELQL
VHYQIEAGNELDLFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINI
TVAATRKAIHLQCEETGVAKMLAEKLLQANKLHNQGEADDSFFGSHSLNAHAPQFSSTLP
TGIEVKENYPVGSSIIFMNATDLDTGFNGKLVYAISGGNEDSCFIIDIDTGMLKILSPLD
RETTDKYTLNITVYDLGIPQKAAWYLLNVRVLDANDNAPEFLQESYFVEVNEDKEINSEI
IQVEATDKDLGPNGHVTYSIVTDTDKFSIDSITGVVKILYPLDREIQHVYYLKIEARDQA
KEEPQLFSTVLLKVSLEDVNDNPPKFIPPNYRVKVREDLPEGTIIMWLEAYDPDLGQSSQ
VRYSLIDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPLSLSSTCYVEVE
VIDVNENLYPPVFSSFVEKGVVKEDVPIGSVMTVSXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVIETSDRLDRESTSRYWLTVYATDQAVVPLSSFIEVYIEIEDVNDNAPQTSEP
VYYPEIIENSPKDVSVVQIEAFDPDSSSNDKLTYKITSGNPQGFFTVHPKTGLITTTSRK
LDREQQDEHILEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDHRPQFSTSKYEVIPEDTVPETEILQISAIDKDEKNKLIYTLQSSNDPLSLK
KFRLDPATGSLYTSEKLDHETTHQHILTVMVRDQDVPVKRNFARIAVNVSDTNDHAPWFT
SSTYEGRAYESAAIGSVVLQVTALDKDKGENAEVLYSIESGSFRVHRNIGNSFTIDPILG
SIKTAKELDRSKQVEYDLMVKATDKGNPPMSEVTSVHIFVTIADNASPKFTSKEYSVEIS
ETISTGSFVGMVSAHSQSSVVYEIKDGNIADAFDINPHSGSIVTQKALDFETLPIYTLII
QGTNMAGLSTNTTVLVHLQDENDNLPIFVQTEYTGLISESASINSVVLTDKNVPLVIRAT
DLDKESNSLLVYHIVEPSIHKYFAIDPSTGAIHTVQSLDYEETSTFHFTVQVHDMGTPRL
FAEYAANVTIHVIDINDCPPVFSRSLYEASLLLPTYRGVKIITVNATDADSRAFSQLLYS
ITEGNIGEKFLMDYKTGTLTDQNTTQLRSRYELTIRASDGRFASFTSCKINVKERKESHL
KFTQNVYSPVVRTDSTEARTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGLISLVRGLDYEQFQQHKIFVRAVDSGMPSLSSEVIVTVDVTDLNDNPPLFDQHIYEA
KISEHATHGHFVTCVKAYDADSSDIDKLEYSILSGNDHKNFVIDSETGIITFSNLRRHTL
KPFYSLNISVSDGVFRSSAQVHITVIGGNLHSPVFLQNEYEVELAENAPLHTLVIEVKAT
DRDSGIYGHFTYHIVNDFAKDKFYTNERGQIFTLEKLDRETPAEKVIAIRLMAKDAGGKV
AFCTVNVILTDDNDNAPQFRATKYEVNIGSSASKGTSVIKVLASDADEGSNADVTYAMEA
DSESVKENLEINKLSGIITTKESLIGLENEFFTFFVRAVDNGSPPRESVVPVYVKILPPE
IQLPKFSEPFYTYTVSEDIPIGTEIDLIRAEHSGTILYSLVKGNTPESNRDEFFVIDKQS
GRLKLEKSLDHETTKWYQFSILARCTHDDYEVVAFVDVSIQVKDANDNSPVLESNPYEAF
IVENLPGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDREKRDNYLLTLT
ATDGTFSSKAIVEVKVLDANDNSPVCEKDLYSDMIPEDAFPGKLVMQVSATDADIRSNAE
IAYTLFGPGAEKFQLNPDTGELKTLAPLDREEQAVYNLQVKATDGGGRFCQANIVLTLDD
VNDNTPEFSADPYTVTVFENTEPGTLLTRVQASDADAGLNRKITYSMINSADGQFSINEL
SGIIQLERPLDRELQAVYTLTLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGA
TVSEDILIGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYEN
SHEYYLTVEATDGGTPSLSDVATVNINVTDINDNTPVFSQDTYTAVIGEDAVLEQSVITV
MADDADGPLNSHIHYSIIDGNQGSPFTIDPNKGEVKVTKLLDRETISGYTLTVQASDNGS
PPRVNTTTVNIDVSDVNDNAPLFSKGNYSVFIQENKPIGFSVLQLVVTDKDSSHNGPPFF
FTIENGNNDKAFEINQQGVLLTSAAIKRKVKDHYLLHVKVEDNGKPQLSSLTYVDIRVIE
ESIYPPAIFPLEIFITTVGEEYSGGVIGKIHATDQDVYDTLTYSLDPQMDNLFSVSSTGG
KLIAHKKLDIGQYPLNISVTDGKFTTAADITVHIRQVTQEMLNHTIAIRFANLTPEEFVG
DYWRNFQRALRNILGLKRNDIQIVSLQPSEPHPHLDVLLFVEKSGSAQVSTKQLLHKINS
SLTDIEEIIGVRILDIFQKLCAGLDCPWKFCDEKVSVDENVMSTHSTARLSFVTPRHHRT
AVCLCKEGKCPLVHHGCEDNPCPQGSECVSDPREEKYTCVCSGGKFGQCPGSSSLTFSGN
SFVKYRLMDNENKLEMKLTMRLRTYSTHAVVMYARGTDYSILEIHNGRLQYKFDCGSGPG
IVSVQSIQVNDGLWHAVSLEVNGNYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGGHIR
QQGTRHGRSPQVGNGFRGCMDSIYLNGQELPLNNKPRSHAHIEESVDVSPGCLLTATEDC
SSNPCQNGGICNPSPTGGYYCKCNALHIGTYCEVSVNPCSSNPCLYGGTCVVDNGDFVCQ
CRGLYTGQRCQISPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECVGNPCQ
NGALCENTPGSYHCNCSREYTGKHCEEAAPNQYVSTPWNIGLAEGIGIMVFIMGIFLLVV
MFVLCRKMINRKKKHQAEPEDKHLGPSTAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYT
PSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPNLPPPPPSNSP
SDSDSIQKPNWDFDYDTKVVDLDPCLSKKPLEEKPSHPYSARESLSEVQSLSSFQSESCD
DNGYHWDTSDWMPAVPLPDIQEYPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPP
PPEDFPAPDELPPLPPEFSDQFESIHPPRDMPATGSLGSSSRSRQRFHLNQYLPNFYPID
MSEPHKTGPGENSTYREPYAPYPPGYQRNFDAPTVENMPMSVYTSTASCSDVSACCEVES
EVMMSDYESGDDGHFEEVTIPPLDSQQHTQV
Download sequence
Identical sequences ENSEEUP00000002753 ENSEEUP00000002753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]