SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002757 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002757
Domain Number 1 Region: 492-670
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-45
Family SPRY domain 0.0025
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-17
Family B-box zinc-binding domain 0.0000138
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000149
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 4 Region: 362-405,449-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000172
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002757
Domain Number - Region: 106-161
Classification Level Classification E-value
Superfamily RING/U-box 0.00247
Family ZZ domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002757   Gene: ENSEEUG00000003005   Transcript: ENSEEUT00000003003
Sequence length 699
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_924:50997:126581:1 gene:ENSEEUG00000003005 transcript:ENSEEUT00000003003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEPITAFQCPTCR
YVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRERTYRPSTAMSSERIACQ
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPMPDTHLRGITCLDHEN
EKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQ
MAKLIQICQQVEVSAGSQEARIELVRRETKVMKLRKLAQQVANCRQCLERSAVLINQAEH
ILKENDQARFLQSARNIAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFISKSWCSWGLW
PEIRKCKEAVSCSRLAGAPRGKCLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFIVKAI
NQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTG
CYGAAGNIFIDSGCHYWEVVMGSSTWYAVGIAYKSAPKNEWIGKNASSWVFSRCNSNFVV
RHNNKEMLVDVPPQLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNK
SLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences ENSEEUP00000002757 ENSEEUP00000002757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]