SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002795 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002795
Domain Number 1 Region: 149-216
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.45e-21
Family Thyroglobulin type-1 domain 0.0000247
Further Details:      
 
Domain Number 2 Region: 61-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002795   Gene: ENSEEUG00000003053   Transcript: ENSEEUT00000003043
Sequence length 229
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6640:19802:23914:1 gene:ENSEEUG00000003053 transcript:ENSEEUT00000003043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPPLLLLLLSLLLAARPGGTSARCTGCGQGAAAECPGGCLQERNGGPPEEGCAEAGGCL
RKEGQPCGVYLAQCAPGLQCRPPEDELPLQALLQGRGRCRRARAPSAAGDTPKESRPRPG
ATRPQDGNRRDPQRNPGVSATLTRPSSGGVPDAEMGPCRKHLDSVLQQLQTQVYRGSHTL
YVPNCDHQGFYRKRQCRSSQGQRRGPCWCVDRMGAPDSDGCGGPAGSSG
Download sequence
Identical sequences ENSEEUP00000002795 ENSEEUP00000002795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]