SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002917 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002917
Domain Number 1 Region: 134-235
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.99e-35
Family MBT repeat 0.00000655
Further Details:      
 
Domain Number 2 Region: 45-160
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.73e-34
Family MBT repeat 0.0000174
Further Details:      
 
Domain Number 3 Region: 566-639
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.36e-19
Family SAM (sterile alpha motif) domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002917   Gene: ENSEEUG00000003182   Transcript: ENSEEUT00000003182
Sequence length 642
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7029:56737:103652:-1 gene:ENSEEUG00000003182 transcript:ENSEEUT00000003182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILFYYSDLACKNFWDLLFIMGLPLCHFTWDKYLKETCAVPAPAHCFKQSYTPPSNEFKIS
MKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIGSCEKNGG
MLQPPLGFRLNASSWPMFLLKTLNGAEMAPIRIFHKEPPSPSHNFFKMGMKLEAVDRKNP
HFICPATIGEVRGSEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPPGTKVVI
PKAPYPASGVNTEKPGIHNSTKTLWEHQQGQRGRKAGKKRGRTPKPLAPHPISTPTKSAD
SLKCPKKRGPKPGSKRKPRTLLNPPHTSPTTSTPEPDTGTVPQDAATIPSSAMQAPTVCI
YLNKKGSTGPHLDKKKVQKLPDHFGPARASVVLQQAVQACIDCAYHQKTVFSFLKQGHGG
EVISAVFDREQHTLNLPAVNSITYVLRFLEKLCHNLRSDNLFGNQPFTQTHLPLSTTEYS
HSHDRYLPGETFILGNSLARSLEPHSDSMDSTLNPTNLVSTSQNLRTPGYRPLLPSCSLP
LNTASAMRRLCSRGSDRYLESRDASRLNGRDPSSWTVEDVMQFVREADPQLGPHADLFRK
HEIDGKALLLLRSDMMMKYMGLKLGPALKLCYHIDRLKQGKF
Download sequence
Identical sequences ENSEEUP00000002917 ENSEEUP00000002917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]