SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003054 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003054
Domain Number 1 Region: 8-65
Classification Level Classification E-value
Superfamily PH domain-like 0.00000142
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003054
Domain Number - Region: 230-268
Classification Level Classification E-value
Superfamily PH domain-like 0.00685
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003054   Gene: ENSEEUG00000003327   Transcript: ENSEEUT00000003337
Sequence length 372
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6815:33350:77764:1 gene:ENSEEUG00000003327 transcript:ENSEEUT00000003337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLAVGAGAVGSLQLTYISKVSIATPKQKPKTPFCFVINALSQRYFLAHDQKDLKDWVEAL
QASKITVPKNLRSPWTTEVLHTPVAAPPAQKKKPSPYKPEIIGVVVHTPINQNGGDGQEG
NEPVSHAILRRSQSYIPTTGCRVPSGPPLIKSGYCVKQGNVXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADSPEDMHSWI
KEIGAAVQALKCQPRELSFSRSTSLTRSGSSSLSAMPSSLLNRGREKRKALCKAPTVASS
WQPWTPVPQAGEKLLPAEETPEDSLFTSRLGESNISGMLSSSRIRHRSEPQHPKEKPYIF
NLDDENIRTSDV
Download sequence
Identical sequences ENSEEUP00000003054 ENSEEUP00000003054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]