SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003102 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003102
Domain Number 1 Region: 288-460
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-59
Family SPRY domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 6-68
Classification Level Classification E-value
Superfamily RING/U-box 6.68e-17
Family RING finger domain, C3HC4 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003102   Gene: ENSEEUG00000003405   Transcript: ENSEEUT00000003394
Sequence length 467
Comment pep:novel scaffold:HEDGEHOG:scaffold_295441:818:12252:1 gene:ENSEEUG00000003405 transcript:ENSEEUT00000003394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASALSISEKMREEATCSICLQLMTKPVNIDCGHSFCRLCLVDITKNQHSLTFQGMLNCP
LCRSPFQSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXKKLQEAATTVRVHEYKCRVQKLFTEDQIKEWEEKIELKRQ
EIQSDFTNLHNFLHEEEKSYLWKLEKEREQILKRLRDSEVSLDKKSHELQTHILELEEKC
QGSAQNLLQDVKNTLIRSSGMKLETPEDISLDIHTICNVPEFYFDLKTMLKRYQVSVTLD
PDTPHHELILSEDQRQVTCGCNQRKIISSRRFSILHCVLGCESFTSGRYYFEVDVGEGTQ
WDLGVCLENVPRDITTIQGPHSGFWVIRLCNTKGYVALTSPLTSLPLKEKPLVVGVFLDY
EAGLVSFYNMTTGSHIFTFPKATFSDTLRPFFQVYHYSPLFLPPPHE
Download sequence
Identical sequences ENSEEUP00000003102 ENSEEUP00000003102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]