SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003128 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003128
Domain Number 1 Region: 2752-2916
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.27e-36
Family Laminin G-like module 0.0000000774
Further Details:      
 
Domain Number 2 Region: 2922-3103
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.84e-34
Family Laminin G-like module 0.0000000439
Further Details:      
 
Domain Number 3 Region: 2138-2314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.78e-24
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 2506-2616
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000633
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 5 Region: 1048-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 6 Region: 284-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 7 Region: 411-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family EGF-type module 0.075
Further Details:      
 
Domain Number 8 Region: 1872-2096
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000144
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Domain Number 9 Region: 1466-1517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 10 Region: 955-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000237
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 2306-2370
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000137
Family Laminin G-like module 0.034
Further Details:      
 
Domain Number 12 Region: 1002-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000198
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1515-1553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 341-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 15 Region: 1423-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003128
Domain Number - Region: 86-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000164
Family APC10-like 0.053
Further Details:      
 
Domain Number - Region: 762-799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000254
Family Laminin-type module 0.031
Further Details:      
 
Domain Number - Region: 2434-2507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000334
Family Laminin G-like module 0.039
Further Details:      
 
Domain Number - Region: 1107-1151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 481-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 1627-1866
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003128   Gene: ENSEEUG00000003321   Transcript: ENSEEUT00000003427
Sequence length 3105
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8296:40251:677614:1 gene:ENSEEUG00000003321 transcript:ENSEEUT00000003427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAAWVLLVLLLSGGLAGGQAQQQRQPQAHQQRGLFPAVLNLASNALITTNATCGEKGP
EMFCKLVEHVPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIKNGIEYHY
VTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIY
PRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADEPSPELLEFTSARYIRL
RFQRIRTLNADLMMLAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPVTN
KSHCECEHNTCGESCDHCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENIAIRN
LSLNIHGKYIGGGVCVNCTQNTAGINCETCIDGFFRPKGVSPNYPSPCQPCYCDPVGSLS
EVCVKDVKHAPKGLAPGSCYCKSGFGGVICDRCARGYFGYPDCRPCNCSGIGSTNEDPCV
GPCNCKDNVEGGDCNHCKPGFFNLQEDNPKGCDECFCSGVSNRCQSSYWTYDNIQDMNGW
FLTDISGHIRVTPQKDFQEISISTLEAQRSLPQNYFWSAPATYLGNKFTAAGGQLAFSFS
YNSEEEDTQHTLQIMVILEGNGLRISTVQDEVYLHSEEHINVFQLKEELFTKYGTNYPVN
RKEFMTVLANLKRLLIQITYSLRMDAIFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNCKDHTGGPYCSQCLP
GFFGDPTKGTSDDCQPCACPLMPSYFSPTCHLDRSLGLICDECPDGYTGPRCEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPETFGLQSGRGCIPCNCNSF
GSKSFDCEENGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACDCAHLGNNCDPKTGQCIC
PPNTIGEKCSKCAPNTWGHSIVTGCKACNCSAVGSLDFKCNRNTGQCNCHPKFSGAKCTE
CRRGHWNYPHCIPCDCFLPGTDSTTCDSETKECYCSDQTGQCTCKVNVEGIHCDKCQSGK
FGLDAKNPLGCSSCYCFGVSTQCSEAKGLIRTVLTLQPQQTILPLVDEALQHTTTKGIAF
QQPEIIAHMDPVRQDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEARDEIGFSTYKP
QVIIRGGTPSHARIITRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRVSRTVTREDFMDI
LYDIHYILIKATYGNGMRQSRISEISMEVAEQGHRTAVTSPAHLIERCDCPPGYSGFSCE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNCQHHTAGDFCERCS
LGYYGIVRGSPNDCQQCACPLTSSSNXXXXXCVMERLDDYRCTACPRGYEGQYCERCSPG
YTGSPSSPGSSCQECECDPQGSLPVPCDPVTGICTCRPGATGQKCDGCRQWHAREGMECI
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLLSPQRAPERL
TQLAEGSLSTLTTEMNELLTRATKVTADGKQTGQDAERTNGRASSLRESMKKLVQDAEAV
NEKAVKLNETLGTQDKAFERNLQELQKEIDQMLTELRRKNLDTQKEVAEDELVAAEGLLK
KVKKLFGESRGKNEAMEKNLRERLEDYQNKVDDAQDLLREAVEKIREANRLSAINQKNMT
ALDHKKEAIESGKQQIENTLKEGSEVLDEASRLANEIKSVIDYVEDIQTKLPHMSDELKS
KIDELSQEVKDRKLAQKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIK
DYIDEAEKIAREAKGLAHEATKLATHPDGSLKEVAKSSLQKSFGILNEAKKLANDVKEND
DRLNGLTARLENADAQNENLLKTLNDTLGKLATIPNDTAAKLQAVKDKARQANNTAKDVL
AQIKDIHQNLHGLKRNYNQLADSVAKTNAVVKDPSKNITDADATVKNLEQEADRLLDKLK
PIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIIVNV
KTHVADNLLFYLGSAKFVDFLAIEMRKGKVSFLWDVGSGVGRIEYPDLTIDDSYWYRIEA
SRTGRNGTISVRALEGPKASIVPGTYHSVSPPGYTILDVDANAMLFVGGLTGKLKKADAV
HVITFTGCMGETFFDSKPIGLWNFQEKEGDCKGCTVSPQVDDSEGTIQFDGEGYALVSRP
IRWYPNISTVMFKFRTFSSSALLMYLATRDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXNISIVDIDTNQEENIATSSSGNNFGLDLKADDKIYFGGLP
TLRNLSTSKEPEVNLNKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPKP
GFVELPPVSIDVGTDINLSFSTKNESGIILLGSGGTLRRKRRQTGQAYYAIFLNKGRLEV
HLSTGTRTMRKIVVKPEPSLFHDGREHSVHIERNRGXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCAAESEPALLIGSKQFGLSKNSHIAIA
FDDTKVKNRLTIEFEVRTEAESGLLFYMARINHADFATVQLRNGLPYFSYDLGSGDTNTM
IPTKINDGQWHKIKIMRIKQEGIIYVDGASNRTVSPKKADILDVVGILYVGGLPINYTTR
RIGPVTYSIDGCVRNLQMAEASADLEQPTSSFHVGTCFASAQKGTYFDGTGFAKAVDGFK
VGLDLLIEFEFRTTRTTGVLLGISSQKMDGMGIEMIEEKLMVHVDNGAGRFTAVYDAGLP
GLLCDGQWHKVRANKLKHRIELTVDGNQVEAQSPNQASTSADTNDPVFIGGFPAGLKQFG
LTTKVRFRGCIRSLRLTKGTGKPLEVNFAKALELTGVQPVSCPVN
Download sequence
Identical sequences ENSEEUP00000003128 ENSEEUP00000003128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]