SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003147 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003147
Domain Number 1 Region: 396-459
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.00068
Further Details:      
 
Domain Number 2 Region: 4-175
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.03e-22
Family BAR domain 0.023
Further Details:      
 
Domain Number 3 Region: 573-676
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-21
Family Ankyrin repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 260-337
Classification Level Classification E-value
Superfamily PH domain-like 4.87e-19
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003147   Gene: ENSEEUG00000003423   Transcript: ENSEEUT00000003449
Sequence length 677
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_729:429:13940:1 gene:ENSEEUG00000003423 transcript:ENSEEUT00000003449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXGECLDKFSESLNHKLDSHSELLDATQHTLQQQIQTLVKGLRGFR
EARRDFWRGAESLEAALTHNAEVPRRRIQEAEEAGAALKTARAGYRGRALDYALQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHQLVLNSAREKRDMEQR
HVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKKY
KDPVTVVVDDLRLCTVKLCPDSDRRFCFEVVSPSKCYQADERLQLSVSSIAQAHLDDSPR
GPGQGSGHLAVGSAATLGYSGMARGREPGGGGHVAAQVQSVDGNAQCCDCREPAPEWASI
NLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXSPSDDLGSLQPGALLFRAAGQPPCLPTMADALAHGADVNWVNGEQENATPLIQ
ATAANSLLACEFLLQNGANVNQADNHGRGPLHHATILGHTGLACLVLKRGADLGALDSEG
RDPLTIAMETANADIVT
Download sequence
Identical sequences ENSEEUP00000003147 ENSEEUP00000003147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]