SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003151 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003151
Domain Number 1 Region: 644-820
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-40
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 830-945
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-35
Family Pleckstrin-homology domain (PH domain) 0.0008
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003151
Domain Number - Region: 99-240
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000144
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003151   Gene: ENSEEUG00000003436   Transcript: ENSEEUT00000003455
Sequence length 1104
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8752:106563:139492:1 gene:ENSEEUG00000003436 transcript:ENSEEUT00000003455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLQTKEQDPSGVRSLLGPMSLHLRLAQGESDSQGGGLAGDPVPGKAVPAVLGPGGLDSD
SVGPGDTLSATSSEQLETELSKFSLLKPTDYLLAQDLSWELLASGMATLPGTRDVDGRAV
LILCAHSPAWLHPKCSSHELICFLLYLKNIPSPKVQALGLTVLVDARVCFPNSSLLWGLS
QLQEAAPGSVHQVLLVGKMPEEVPSGLQLEQMSSRQSLLAHISATELPASLGGSLPYCHQ
TWLDFRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQIRQ
GEKLLQPLTGWEAVELGPFGARFLDLQAELTEFSRALALRRQRLADAERLSRFFKQASTW
AEEGQRVLAELEQKRPGVVLQRLQLHWTKHPDLPPAHFRKMWALATGLGSEGIRQECRRA
WAWCQDTWLALDQKLEAALKPPPTGSTSSLCVSPIQAVPTTPPLRKAYSLDRNLGQSLKN
PAHDCHPVGIVGACRRPEARDGAQLGPSPIMPLLGSSDTRSPNRLQLVLVEMVTTEREYV
RALDYTIENYFPELDRPDVPQGLRGQCARLFGNLEKLRDFHHHFFLRELEACSRHPPRVV
YAFLRHRVQFGMYALYSKNKPHSDALMTSYGHAFFKDKQKALGDHLDLASYLLKPIQRMS
KYALLLQELARACGGPVQELSALQAAQSLVRFQLRHGNDLLAMDAIQGCDVNLKEQGQLV
RQDEFTVRSGRHKSLRRIFLFEDLLLFSKPRRGPTGMDTFTYKRSFKMADLGLTECCGDS
DLRFEIWFRRRKARDTFVLQAASLATKQAWTADISRLLWRQAVHNKEVRMAEMVSMGVGN
KAFWDITPSEEAISDRTINYVLKCREVRSRASIAVAPLDYDSSYLEASSPLPGDPASCSV
LGPLNLHLYRDPALQGLRWPLYSTSFPEEAALEPEAELGSQPSLTPEDSEVSSQCPSASG
SSGSDSSCMSGQALGRGLEDVSYV
Download sequence
Identical sequences ENSEEUP00000003151 ENSEEUP00000003151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]