SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003176 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003176
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 403-510
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.51e-27
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000261
Further Details:      
 
Domain Number 3 Region: 303-400
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-27
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000368
Further Details:      
 
Domain Number 4 Region: 664-778
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.07e-27
Family MAM domain 0.0028
Further Details:      
 
Domain Number 5 Region: 121-194
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-18
Family Spermadhesin, CUB domain 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003176   Gene: ENSEEUG00000003469   Transcript: ENSEEUT00000003485
Sequence length 890
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1276:22934:157938:-1 gene:ENSEEUG00000003469 transcript:ENSEEUT00000003485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCGDTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYD
YVEVIDGKNENGRLWGKFCGKIAPSPVVSSGPFLFIKFVSDYETHGAGFSLRYEIFKRGP
ECSENYTTPTGIIKSPGFPEKYPNSLECTYIIFAHKMSEIILEFESFDLEPDSNPPGGMF
CRYDRLEIWDGFPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVDLGLLRFVTAVGTQGAISKETKKKYFVKTYRIDVSSNGEDWITIREGNKPVVFQGNT
NPTDVVFGVFPKPLITRFVRIKPATWETGISMRFEVYGCKLTDYPCSGMLGMVSGLISDS
QITASNQADRNWMPENTRLVTSRSGWALPPAPHPYSNEWLQVDLGEVKLVRGLIIQGGKH
RENKVFMRKFKIGHSNNGSDWKMIMDDSRRKAKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTT
MLTTEEPTVIDSTMQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXDGNFIYSQADANQKGKVARLVSPVVSSQSSAHCMTFWYHMSGSHVGTLRVKLRYQRP
EEYDQLVWTAVGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHIP
QEDCVKPADLDKKNQDNIIDDTGSTPGYEGMAEGDENISRKPGNVLKTLDPILITIIAMS
ALGVLLGAVCGVVLYCACWHSGMSERNLSALENYNFELVDGVKLKKDKLN
Download sequence
Identical sequences ENSEEUP00000003176 ENSEEUP00000003176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]