SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003240 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003240
Domain Number 1 Region: 417-586
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-41
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 359-446
Classification Level Classification E-value
Superfamily Fibronectin type III 9.26e-19
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 138-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.43e-17
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003240
Domain Number - Region: 46-82
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00314
Family TFIIH p44 subunit cysteine-rich domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003240   Gene: ENSEEUG00000003561   Transcript: ENSEEUT00000003556
Sequence length 596
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2812:14085:76722:1 gene:ENSEEUG00000003561 transcript:ENSEEUT00000003556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGVGQGASAVPEMAICQLCDRTPPEP
AAKLCEQCDVLYCAACQLKCHPSRGPFAKHRLVQPPGPLGPAETRSASPSATQGAPSGGG
SYKSPGGAGVGSSGGSSARKFPTCPEHEMENYSMYCVNCRTPVCYLCLEEGRHGNHDVKP
LGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPIPLLQ
LEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGNGGQFREVYVGKETLCTIDGLHFNS
TYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRV
VLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWF
MHCNSHTNRTEGGVCKGAIVGVLLDLNKHTLTFFINGQQQGPTAFSHXXQSENHFI
Download sequence
Identical sequences ENSEEUP00000003240 ENSEEUP00000003240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]