SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003252 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003252
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily PH domain-like 8.69e-28
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 
Domain Number 2 Region: 315-400
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.4e-19
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 3 Region: 1079-1146
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.86e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 738-878
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.000000000000501
Family NAD kinase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003252   Gene: ENSEEUG00000003518   Transcript: ENSEEUT00000003569
Sequence length 1152
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_825:26571:84154:1 gene:ENSEEUG00000003518 transcript:ENSEEUT00000003569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVLKEGVLTKQNSSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVN
NSFTVITPCRKLILCADNRKEMEDWMAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHA
RPTYCNVCREALSGVTSHGLSCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDL
ARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSVMAYETKLPRPASSSTGTEDFSEGS
EVRQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTEGSEES
EVMAKKCSVLKEKLDSLLRTLDDESQASSSLPTPPPTIAEEAEDGGRGSGCSSAGERPMG
SACPGLRPIFRTQEHISLRSGLINAFRQIFDQSEKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXTKSPCEKLLSKGSLSLGSSASLPPPSASRDGLPA
LNTKILFPTVRAMSGSLPGGSVITRLLIYADPVSSDPENLXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSL
QGIAVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIKLQHHR
IAQCRTVKISILGDDGVPVQDGEAWVQPYIHVKNRAQTLTGQAFENTLKSWEDKQKCELP
RPPSFSLHPEILSEEEATQMDQFGQAAGTLIHXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLDPPQKERLGAALTEMDR
QLGKLADTPWLCQSPEPGDEEAVMLDLSKRGRSGKFRLVTKFKKEKNNKNKEARSSLGTP
VHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILCG
IKELNRGPPSEA
Download sequence
Identical sequences ENSEEUP00000003252 ENSEEUP00000003252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]