SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003329 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003329
Domain Number 1 Region: 329-386
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000088
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003329   Gene: ENSEEUG00000003637   Transcript: ENSEEUT00000003653
Sequence length 501
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_404:31878:200215:-1 gene:ENSEEUG00000003637 transcript:ENSEEUT00000003653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDN
ENKILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVHCISTEFTMRKHGGEKGVPFRVQIDTFKENENGEYTEHLHSASCQIKVFKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSGADLLKL
TRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGES
NGTFFVYHAIYLEELTAVELTEKTQLFSISPRQISQXXXXXXXXXXXXXXXXMIQNFQEE
ACFILDTMKAETSDSYHIILK
Download sequence
Identical sequences ENSEEUP00000003329 ENSEEUP00000003329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]