SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003346 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003346
Domain Number 1 Region: 356-484
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-22
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 2 Region: 206-309
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003346
Domain Number - Region: 505-556
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0247
Family Di-heme elbow motif 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003346   Gene: ENSEEUG00000003682   Transcript: ENSEEUT00000003673
Sequence length 702
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7484:4243:140338:-1 gene:ENSEEUG00000003682 transcript:ENSEEUT00000003673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALEVDDISPALEVTEDFFSTFDSKIEKTVQQAEVYGIQEVPELVGHEVLSNRTDNGAT
RTADSLGQGGMVWDHCKGRILETKAQNVFPAKEQFMVQKGTTPDNLSWMEQKEASTFNFF
NMCQRRRDRPRSVNDLLDETSTFKPGHARSRSDITQMDWRVVLKTMPLQQQQEQTSLPEP
RFTRPSFLLPSPNKVEDAQGNTEHKQAFPNILKKGYLEIRKSHDSYWQSCYAELSPYNLY
FYNLDSSGNQTLCATYQLSHFQSISVLGNLEARLVDTVLYDNTQLQLKAESPWEALDWGQ
KLWEVVHATTVPGYMAQQDQLANSPGLGHHADCAQNHCLQKNSSELLVPSPVLDSPKQYQ
NILKSGTLYRLTVQNNWKAFSFVLSQAYLMAFQPGKLDEDPLLSYNVDVCLAVQMDNLDD
CDSCFQVIFPQDVLRLRAETRQRAQEWMEAMKTAANAARSSEQNLQVTLRNKPKDQIGGH
ELRKSKRQSVTTSFLSILTTLSLERGLTVQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCS
SCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLAT
VVRLRQRLKSLRAYLFSCRAAVAEDLRRXXXXXXXXXXXXXXXXXXXXXXVIEGKLAPFL
GKVIKFATSHVYSCSLCSQKGFICEICNNGEILYPFEDISTS
Download sequence
Identical sequences ENSEEUP00000003346 ENSEEUP00000003346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]