SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003361 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003361
Domain Number 1 Region: 62-195
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000759
Family PX domain 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003361
Domain Number - Region: 229-278
Classification Level Classification E-value
Superfamily PH domain-like 0.0739
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003361   Gene: ENSEEUG00000003652   Transcript: ENSEEUT00000003689
Sequence length 931
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3423:172:49940:1 gene:ENSEEUG00000003652 transcript:ENSEEUT00000003689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTSPESLFPPGDDLDSGQLHMEPDEMDTLKEGEDPADRMHPFLAIYNLQPLKAYPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRELLRHKVL
MSLLPLARFAVAYSPARDAANREIPSLPRVGPEGSSRHASSKQKYLENYLNRLLTMSFYR
NYRAMTEFLEVSQLSFIPDLGSKGVEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGTISFVQLFDPGFEVQVGKKSTEARYGVWIDTSHXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPPSSGPDSQTTPDLSDNQLFWLGKDYSNLITKDWVQLNRPFEDFIDRETIPGMPW
RDVGVVVQGSPDRDLGRFRLWNINKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVILGADSRPNLDLRDPICDDF
FQLWQDIAESNANLYEQIFRCLPSNATRSLRALREYVAVEPLATVSPPLARSELTQVQGH
LVHFPLKFLEDESLLPPLGSKEGVMPLEVWT
Download sequence
Identical sequences ENSEEUP00000003361 ENSEEUP00000003361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]