SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003368 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003368
Domain Number 1 Region: 67-145
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000157
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003368   Gene: ENSEEUG00000003727   Transcript: ENSEEUT00000003696
Sequence length 147
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7592:1283:9562:-1 gene:ENSEEUG00000003727 transcript:ENSEEUT00000003696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMRFLQLLRIPFLCGLLWAFYVLDARAEEPGAGSSHHGSVGLDKNTVHDQEHIMEHLEG
VINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAISHAHKVEGNEQAPMSETERIT
LIDGVLRDDDKNNDGYIDYAEFAKSLQ
Download sequence
Identical sequences ENSEEUP00000003368 ENSEEUP00000003368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]