SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003421 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003421
Domain Number 1 Region: 124-318
Classification Level Classification E-value
Superfamily vWA-like 8.01e-61
Family Integrin A (or I) domain 0.000089
Further Details:      
 
Domain Number 2 Region: 433-617
Classification Level Classification E-value
Superfamily vWA-like 2.08e-56
Family Integrin A (or I) domain 0.00019
Further Details:      
 
Domain Number 3 Region: 1228-1379
Classification Level Classification E-value
Superfamily vWA-like 1.41e-38
Family Integrin A (or I) domain 0.00048
Further Details:      
 
Domain Number 4 Region: 2298-2405
Classification Level Classification E-value
Superfamily vWA-like 3.81e-24
Family Integrin A (or I) domain 0.0033
Further Details:      
 
Domain Number 5 Region: 634-803
Classification Level Classification E-value
Superfamily Fibronectin type III 1.47e-23
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 6 Region: 2027-2196
Classification Level Classification E-value
Superfamily Fibronectin type III 7.15e-23
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 1569-1726
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-20
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 8 Region: 906-1075
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-20
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 9 Region: 1386-1473
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-20
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 10 Region: 812-901
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-18
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 11 Region: 332-422
Classification Level Classification E-value
Superfamily Fibronectin type III 2.67e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 12 Region: 1473-1564
Classification Level Classification E-value
Superfamily Fibronectin type III 1.07e-16
Family Fibronectin type III 0.00068
Further Details:      
 
Domain Number 13 Region: 26-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000104
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 14 Region: 2206-2291
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000856
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 15 Region: 2615-2723
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000304
Family Laminin G-like module 0.081
Further Details:      
 
Domain Number 16 Region: 1944-1976
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000476
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 17 Region: 1798-1843
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000671
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003421   Gene: ENSEEUG00000003546   Transcript: ENSEEUT00000003754
Sequence length 3060
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2252:520:187997:-1 gene:ENSEEUG00000003546 transcript:ENSEEUT00000003754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRLPSALAALGVALLLSSIEAEVDPPSDLNFKIIDENTVHMSWEKPDDPIEGYKVTVA
STNDGPTKEFTLAPSTTETLLSDLIPEVEYVVTITSYDEVEESVPVIGQLTIQTGGPMKP
GEKRPGKTEMQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYKRNELLSAIKSIPYKGGNTMTGDAIDYLIKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRGIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELISGEEVIEPPSSLVATEVSSKYIKLSWNPSPSP
VTGYKVLLTPMTTGSRHHALSVGPQTTMLSVRDLSADTEYQISVSSMKGLTSSEPVTIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEILANSFDISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVYTVE
DFDAFQRISFELTQSICLRIEQELAAIKRKSYVPPKEISFSDVTSHSFKMNWSPAGENVF
SYHITYKQAGGNDEVTVVEPASSTSVVLNNLKPETLYLVNVTAEYEDGFSIPISGKEVTS
EVKGAPRNLKVTDETTDSFKITWTQAPGKVLRYRIRYRPTAGGESREVTTPANQRRRTLD
NLTPDTKYEVSIIPEYSSGPGSPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGK
VKQYLVTYTPVAGGKTQEVTVKGDTTNTVLRGLNEGTKYALSVTALYASGAGDGLFGEGT
TLEERGSPQDLITKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDIETGEKSLPGDTIHT
VIENLQPETKYKISVFATYSSGEGEPLNGEVTTELSQDSKTLKVDEETEGTMRVTWKPAP
GRVVNYRVMYRPRGGGRQMVVKMPPTATSTVLKRLQPQTTYDITVLPIYKTGEGKVRQGS
GTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXEMEEVFDIAPKRMQTALGQYSGGPRIEWQLNAHRDK
NSLLQAVANLPYKGGKSLTGMALNFIRQQNFKTQVGMRPRARKIGVLITDGKSQDDVEAP
SKKLKDEGVELFAIGIKNADETELKMIATDPDDTHAYNVADFESLSRIVDDLTINLCNSV
KGPGDLEAPSNLVISERTHRSFRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRMETST
VLKDLKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDVGPTTMRVQWQSVGG
ATGYSLMYEPVNTREPAKPKEMHVGPTVNDVQLTDLLPNTEYKVTVQAALHDLTSEPVSA
REVTLPLPRPRDLKLRDVTHSTMNVLWDPVVGKVRKYIIRYKTPEEEFKEVVDRTRTNTP
LKDLSSQTLYTVSVSAVYEEGESPPVTAQETTRPVPAPTNLRISEVTPDSFRGTWDHGAS
DVSLYRVTWAPLGSADKMETILNGDENTLVFENLNPNTLYEVSVTGIYPDESESDDLVGS
ERTLRLIPSTTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
TTIGGRQNSVLLQKLKPDTPYTITVSSLYHDGEGGRMTGRGKTXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTPYTITLYAVYT
EGDGGRTSDTGRTLVRGLARNIEVYPTPNSLDVRWDPAPGPVQQYRVVYSPSRGTRPSES
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRSGPRNLRVFGETTN
SLSVTWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIAVY
EDGDGGHLPGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSSEPM
EAFVGEVTSYTLHNLNPSTTYDVSVYAQYDSGLSVPLMDQGTTLYLNVTDLKTYQVGWDT
FCVRWSAHRAATSYRLKLNPADGTRGQEITVRGSETSHCFTGLAPDTDYGVTVFVQTPNL
EGPGVPIKEHTTVKPTEAPTEPPTPPPPPTIPPARDVCKGAKADIVFLTDASWSIGDDNF
NKVVKFIFNTVGAFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRGG
NTRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXKPQVGPIGGPSSKTLSFFNKDTRGETQTVTFDTEE
VKTLFYGSFHKVHIVVTSKSVKIYIDCYEIVEKDIKEAGNITTDGYEILGKLLKGERKSA
AFQIQSFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRQGMKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSPGSPGVTGPSGKPGKPGD
HGRPGQSGLKGEKGDRVDASQNMMRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSVGAREPGPGGRTSCTPGMQGPPGERGLPGEKGERGLGSSGPRGLPGPP
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSG
Download sequence
Identical sequences ENSEEUP00000003421 ENSEEUP00000003421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]