SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003480 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003480
Domain Number 1 Region: 17-205
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000000155
Family FCH domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003480   Gene: ENSEEUG00000003821   Transcript: ENSEEUT00000003816
Sequence length 250
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5364:27:9772:-1 gene:ENSEEUG00000003821 transcript:ENSEEUT00000003816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIVLDRDSQARVMENTVANAEKYFGQFCSMLASYTRKTARLRDRADQLVRQLLDFANTE
NPEMRATMKNFAEDLAKVQDYRQAQVERLEMKVITPLKLYGAHIKQTRAEIKKFKHAQNH
EIKQLEKLEKLRQKSPSDRQMIXXAETSVQRASVDASRTTRQLEETVDAFQKQKLKDLQR
IFSDFVTIELVFHAKAVEVYSSAFQTLESYDLDRDLDFRAKTRGLYGHHTTRPLTHTGLA
SAAPWFFVSQ
Download sequence
Identical sequences ENSEEUP00000003480 ENSEEUP00000003480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]