SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003563 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003563
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.51e-20
Family FCH domain 0.0000399
Further Details:      
 
Domain Number 2 Region: 402-474
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000433
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003563   Gene: ENSEEUG00000003910   Transcript: ENSEEUT00000003911
Sequence length 488
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6707:15491:49084:1 gene:ENSEEUG00000003910 transcript:ENSEEUT00000003911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQCYERLDNDANATKADVEKAKQQ
LNLRTHMADENKNEYAAQLQNFNGEQHKHFYIVIPQIYKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
SDGTISTSKQSGKMDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTF
SIEPVHYCMNEIKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTG
VRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHNEFDDEFEDDDPLPAI
GHCKAIYPFDXXXXXXLAMKEGELYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEKN
SKGAVTYI
Download sequence
Identical sequences ENSEEUP00000003563 ENSEEUP00000003563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]