SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003567 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003567
Domain Number 1 Region: 389-751
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.18e-97
Family Oxysterol-binding protein 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003567
Domain Number - Region: 4-58
Classification Level Classification E-value
Superfamily PH domain-like 0.0128
Family Pleckstrin-homology domain (PH domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003567   Gene: ENSEEUG00000003891   Transcript: ENSEEUT00000003916
Sequence length 757
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_67:4695:19295:-1 gene:ENSEEUG00000003891 transcript:ENSEEUT00000003916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITKGKLHGSIDVRLSVMSINKKAQRIDLDTEDNIYHLKIKSQDLFQSWVTQLRAHRLAQR
LDMPRGPLPSTTHWKVPGAQLPAAGNTSALPGLGPREKVSSWLRDSDGLDRCSHELSECQ
GKLQELHRLLQSLESLHRIPSAPVIPTHQASVTTERPKKGKRTSRMWCTQSFAKDDTIGR
VGRLHGSVPNLSRYLESRDSSGPRGLPPPDYAHLQRSFWALAQKVHSSLSSVLAAFTNER
DRLGDLHHGSEMPRMGVSEVSAGPQRLHSLSVSSDTTADSFSSLNPEEQEALYMKGRELT
PQLSQSSILSLADSHTEFFDACEVLLSASSSENEGSEEEESCTSEITTSLSEEVLDLRGT
EPCQKGGCVPGRAAGPPRRRCLPAASGPGTDVSLWNILRNNIGKDLSKVSMPVQLNEPLN
TLQRLCEELEYSSLLDQASRTTDPCERMPPLARAPAVSAYSSTYYRAGCNPFNPVLGETY
ECERPDRGFRFISEQVSNPPISAWHANSENFIFWQXXXXXXXXXXXXXXXXXXXXXXXXX
XXFGDHFEWNKVTSCIHNILSGQRWIEHYGEVLIRNTQDSSCHCKITFCKAKYWSSNIHE
VQGAVFSRSGRVLHRLFGKWTEGMYRGPPPSGQCVWKPNSMPPNHERNFGFTQFALELNE
LTSELKRSLPSTDTRLRPDQRYLEEGNIQAAEAQKRRIEQLQRDRRKVMEENNIVHQARF
FRRQTDSSGKEWWVTNNTYWRLRAEPGYGSLDGAVLW
Download sequence
Identical sequences ENSEEUP00000003567 ENSEEUP00000003567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]