SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003591 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003591
Domain Number 1 Region: 141-193
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000133
Family SH2 domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003591
Domain Number - Region: 522-565
Classification Level Classification E-value
Superfamily Ras GEF 0.0144
Family Ras GEF 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003591   Gene: ENSEEUG00000003948   Transcript: ENSEEUT00000003944
Sequence length 828
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6707:59862:196207:-1 gene:ENSEEUG00000003948 transcript:ENSEEUT00000003944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGKFASLPRNMPVNHQFPLASSMDLLSSKSPLAERRADAYQDVSIHGTLPRKKKGPPP
IRSCDSFGHVGTLPHSRSPRHNSPLTQDVIQEHSPQDWKADTFTFRDQQFLDPTLEYVKF
SKEKERHMMDRTPERLKKELEEELQLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRD
SLSSPGNFVLTCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKLPPQSPNVDTS
PCPNSPVFRTGSEPTLSPAVVRRVSSDARAGEALRGSDSQLCPKPPPKPCKAPFLKTPLS
SSPWLNSEANYCELSPAFAASCDMGARPPFCAQDSYVELLTSKQKGGPGPRNSGTNYLIL
DDDDGERPGGLPSALQRSKEQEDKDEFVPPLLENVSSFRPNAFESKLLLPENKPLETAML
KHAKELFTNNDPKVIAQHMLSIDCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQPDEEMSEI
LRTEFQMRLLWGSKGAQVQQAERYEKFSQILTVLSRKLEPPPVKQAEL
Download sequence
Identical sequences ENSEEUP00000003591 ENSEEUP00000003591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]