SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003748 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003748
Domain Number 1 Region: 393-585
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.33e-84
Family Myotubularin-like phosphatases 0.0000000111
Further Details:      
 
Domain Number 2 Region: 87-198
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-39
Family GRAM domain 0.00000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003748   Gene: ENSEEUG00000004115   Transcript: ENSEEUT00000004125
Sequence length 643
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6437:24690:55587:-1 gene:ENSEEUG00000004115 transcript:ENSEEUT00000004125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKSSSCESLGPTPVAARPPSADSLSSASTSHSENSVHTKSASVISSDSISTSADNFSPD
LRXXXXXXXXXXXXXXXXXXXXXXXXXXKDVTYICPFTGAVRGTLTVTDYRLYFKSMERD
PPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLM
KYAFPVSNNLPLFAFEYKEVFPENGWKLYDPLVEYRRQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLILAGALRIADKVESGKASVVVHCSDG
WDRTAQLTSLAMLMLDGHYRTLRGFQVLVEKEWLSFGHRFQLRLGHGDKNHADADRSPVF
LQFIDCVWQMSRQFPTAFEVNEYFLITILDHLYSCLFGTFLCNSEQQRAKENVPQRSVSL
WSYINSQPEDFTNPLYGSYCNHVLYPVASMRHLELWVGYYVRWNPRMKPQEPVHNRYKEL
LAKRAELQKKVEELQREVSNRSTSSSERAGSPAQCTAPVQTVV
Download sequence
Identical sequences ENSEEUP00000003748 ENSEEUP00000003748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]