SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003851 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003851
Domain Number 1 Region: 14-166
Classification Level Classification E-value
Superfamily EF-hand 1.08e-42
Family Calmodulin-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003851   Gene: ENSEEUG00000004271   Transcript: ENSEEUT00000004238
Sequence length 173
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_275953:10981:11502:-1 gene:ENSEEUG00000004271 transcript:ENSEEUT00000004238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSMGNEASYPEEMCHHFDQDEIRRLSRKFKKLDLDGSGTLSVKEFMLLPAMQQNPLVQR
VIDIFDTDGNGEVDFKEFIRGTSQFSVKGEEEQKLRFAFSIYDIDKDGFISNGELFQVLK
MMVGDNLKDWQLQQLVDKTIIILDHDNDGKISFEEFRAAVGNLEVHKKLVVAV
Download sequence
Identical sequences ENSEEUP00000003851 ENSEEUP00000003851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]