SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003972 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003972
Domain Number 1 Region: 288-407
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-23
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003972   Gene: ENSEEUG00000004340   Transcript: ENSEEUT00000004367
Sequence length 428
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2102:1611:138626:-1 gene:ENSEEUG00000004340 transcript:ENSEEUT00000004367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRXXXXXXXXXXXXXXXXXXXXXXXXXSWPWIHSTPGQYQTFDEPLLHQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRATRGSKTPLPPPRPLDTLPKKYQPLPPEP
LCSWSPLPLRHPFPEGRPAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXSSFMMSTHLGQNKAHREAMQPHPSRKGRSPTSCDPCDSCKPPSWRAPYPVRAD
AKGISHNEWYIGDLSRQAVEEALVRENKDGTFLVRDCSTKSRAEPYVLVVFYRSKVYNVK
IRFLERNQQFALGTGRRGDEKFDSVEDIIEHYKYFPIVLIDGKDKTGVRREQCYLTQPLP
LHRHCTSQ
Download sequence
Identical sequences ENSEEUP00000003972 ENSEEUP00000003972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]