SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004018 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004018
Domain Number 1 Region: 347-474
Classification Level Classification E-value
Superfamily Second domain of FERM 8.02e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 476-580
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-24
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 3 Region: 127-214
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000126
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 93-124
Classification Level Classification E-value
Superfamily WW domain 0.0000485
Family WW domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004018   Gene: ENSEEUG00000004387   Transcript: ENSEEUT00000004418
Sequence length 1376
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6852:90771:437044:1 gene:ENSEEUG00000004387 transcript:ENSEEUT00000004418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPRPGAGYPRPPPPAIAATTQPRGAPRSHWPWGCRLCRCWREKERQTRSAGPPAACMDV
FSFVKLAKLSSHRTKSSGWPPPSGTWGLNQVPPYGWEMMANRDGRDCFINHMTQAIPFDD
PRFESCQIIPPPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVMIN
DEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSEEV
IINGQVSETVKDNSLLFMPNLKXXXXXXXXXXXXXXXXXXXXDVILTLQEKLSIKGIEHF
SLMLEQKTEGAGSKLLLLHEQETLTQVTQRPGSHKMRCLFRISFVPKDPIDLLRRDPVAF
EYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETF
LPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFK
ATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEEESSVRVELH
VLDEAPVILLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKPAGTQETGAENKGKHN
LLGPDWNCIPQVTTFLGEGEPEAQITYIDAKQKPVEITDGTLCAKDHRHLYLDNTYNAND
LTQPLAPPGEAPCEANYRSLAQRSLMTLAGPETLQKAQESPRGAKVSFIFGDLGLEDGLN
PPTLGYERLLEESPELLEKQGSLYISSANDMKNLDLAPDAQSIQFVANSVYANIGDVKNF
EAAEGIEEPLLHDICYAENPDDAEDEDEVSCEEDLVVGEVNQSAILSLSGSSDDIIDLTS
LPPPEGNDTEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFREDKEAGNSVQNDEI
PVSLIDAVPTSAEGQCDKSLDTTGVATLEALEALSVSEEQQTSDNSGVAILRAYSPESSS
DSGNETNSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPTSKAPAGGLPP
KSHALATRPVTDLPPKVVPSKQILHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSK
RKSKLADGEGKVPPGGNLPGKKQQGTKTAEVEEGTKGKCGTMSSRDSQHLSTFNLERTAF
RKDSQRWYVATEGAVAEKSGLEASTGITFPRASGHGTREAEGKEEEAPGGETSEVSGLGQ
RDHFLTDVTCVSSAKDLGNPEDADPSPCDHPSKVPEVEEGVARLCDYHLAKRMSSLQSEG
HFSLQSSQGSSVDAGCGTGSSSSTCATPVESPLCPSMGKHLIPETSGPGGSYIPSDERAI
GLPNHRTTFKELHPHTEGMCPRMTVPALHSAINTEPMFGTLRDGCHRLPKIKETTG
Download sequence
Identical sequences ENSEEUP00000004018 ENSEEUP00000004018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]