SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004061 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004061
Domain Number 1 Region: 426-667
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-68
Family Protein kinases, catalytic subunit 0.000000279
Further Details:      
 
Domain Number 2 Region: 9-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.9e-26
Family PLC-like (P variant) 0.0000268
Further Details:      
 
Domain Number 3 Region: 231-298
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0005
Further Details:      
 
Domain Number 4 Region: 160-224
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004061   Gene: ENSEEUG00000004447   Transcript: ENSEEUT00000004461
Sequence length 682
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_275:338:238859:1 gene:ENSEEUG00000004447 transcript:ENSEEUT00000004461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGTMKFNGYLRVRVGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTST
KQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQDLLRTAGTSDTFE
GWVDLEPEGKVFVVITLTGSFAEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYL
RQPTYCSHCREFIGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHENATGILKSFMTKNPTMRLGSL
TLGGEHAILRHPFFKEIDWAQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEPVTPIDEG
HLPMINQDEFRNFSFVSPELQP
Download sequence
Identical sequences ENSEEUP00000004061 ENSEEUP00000004061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]