SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004076 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004076
Domain Number 1 Region: 18-58
Classification Level Classification E-value
Superfamily EF-hand 0.0000028
Family S100 proteins 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004076   Gene: ENSEEUG00000004498   Transcript: ENSEEUT00000004480
Sequence length 62
Comment pep:novel scaffold:HEDGEHOG:scaffold_348698:1016:4161:1 gene:ENSEEUG00000004498 transcript:ENSEEUT00000004480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASATTSLTYSYLDLHTMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKNELCL
TE
Download sequence
Identical sequences ENSEEUP00000004076 ENSEEUP00000004076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]