SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004102 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004102
Domain Number 1 Region: 395-538
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 226-258
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000207
Family First domain of FERM 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004102   Gene: ENSEEUG00000004467   Transcript: ENSEEUT00000004509
Sequence length 863
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5710:696:176997:1 gene:ENSEEUG00000004467 transcript:ENSEEUT00000004509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVTEAENSPHKQQKEEGEGATNPGQQETQLEEVSQVAAEGDNQCEQKLKTSNGD
TPTHEDLIKNKDRASESRGLSRLFSSFLKRPKSQVSEEEGKEIELAKEKGEEGQKEIEFG
TSLDEIILKAPIAAPEPELKTDPSLDLHSLSSAETQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKHAKGQDLLKRVC
EHLNLLEEDYFGLAIWDNATSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGL
LVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVC
VEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRAS
RSLDGAAAVESTDRSPRPTSAPAIAQSQVTEGGVPGAPVKKPLTSKTQKETVQVEVKQEE
VPPEQAEPEPTESWKVEKTHIKVTVPTSIGEQTQKPAEKSEDLIRMRKKKRERLDGENIY
IRHSNLMXXDLDSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRALNING
QVPTGEGPPLVKTQTVTISDTANAAKSEIPTKDVPIVHTETKTITYEAAQTDDSSGDLDP
GVLLTAQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADVDHDQVLVQAIKEA
KEQHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences ENSEEUP00000004102 ENSEEUP00000004102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]