SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004162 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004162
Domain Number 1 Region: 227-350,389-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.67e-51
Family Protein kinases, catalytic subunit 0.00000000954
Further Details:      
 
Domain Number 2 Region: 117-259
Classification Level Classification E-value
Superfamily SH2 domain 1.13e-37
Family SH2 domain 0.00000283
Further Details:      
 
Domain Number 3 Region: 89-126
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000116
Family SH3-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004162   Gene: ENSEEUG00000004567   Transcript: ENSEEUT00000004571
Sequence length 504
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1477:13728:98261:1 gene:ENSEEUG00000004567 transcript:ENSEEUT00000004571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKFLRNEDKISKTDSSTNPSSPLYVPDPTSSGKRGPNSSNGNPPGSIEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXSGEWWKARSLINRKEGYIPSNYVARVNSLETE
EWFFKGISRKDAERQLLAPGNILGSFMIRDSETTKGSYSLSVRDYDPQHKDAVKHYKIRT
LDSGGFYISPRSTFSTLQELVAHYKKGSDGLCQKLTMPCLSSKPQKPWEKDAWEIPRESL
KLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKTLQHDKLVKLHA
VVTQEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKFPIKWTAPEAINFGSFTIKSDIWS
FGILLMEIVTYGRIPYPGMSTPEVIRSLERGYQMRRPEHCPEELYDIMMRCWKNRPEERP
TFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences ENSEEUP00000004162 ENSEEUP00000004162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]