SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004190 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004190
Domain Number 1 Region: 851-1136
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.53e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000119
Further Details:      
 
Domain Number 2 Region: 95-200
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-28
Family Second domain of FERM 0.00038
Further Details:      
 
Domain Number 3 Region: 242-346
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-19
Family Third domain of FERM 0.0087
Further Details:      
 
Domain Number 4 Region: 9-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-17
Family First domain of FERM 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004190   Gene: ENSEEUG00000004562   Transcript: ENSEEUT00000004603
Sequence length 1141
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_679:3798:55048:-1 gene:ENSEEUG00000004562 transcript:ENSEEUT00000004603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYTVSSKTCLVAPIQLLNNDFVEFTLSVESTGQESLEAVAQRLELREITYFSLWYYNKQN
QRRWVDLEKPLKKQLDKHALEPTVYFGVVFYVSSVSQLQQEITRYQYYLQLKKDILEGGI
PCTLEQAIHLAGLAVQADFGDFDQYESQDYMQKFALLPVGWLQDEKVLEEATQKVALLHQ
KYRGLAAPDAEMLFMQEVERMDGYGEESYPAKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXWHDIANMSHNKSFFALELANKEEAIQFQTEDMETAKYVWRLCVARHKFYRLNQCTLQT
QTVSLNLIRRRSSSRMSLSKPQRYVMPPPPQLHYNGHYTEPYTSSQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPPRTPAEAQAMLGAVSVPELTDAQLQAQDYPG
GNILGTQVYPPPPYPAPRPANSTPDLSRHLDGGSNPDLITRRVHHSVQTFQEDSLPVAHS
LQEVSEPLTAARRAQLHKRNSIEVAGLAHGLEGLRFKERTMSASAADVAPRVPSAGSQPS
VAQPDGQDSLLGYGHKKSLSDATMLVHSSEEEEDLEEDVGLRGALSPHTQGGYPQDPQLD
YPVPVVAGPLHILEPQLHVPEAEKRPREGSPGSRRDGVLTPCMSESDLTTSGRYRARRDS
LKKRPVSDLLSGKKSIVEGLPPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXCRILEHRLEQGVVFTEYERILKKRLVGGECSTARLPENAERNRFQDVLPY
DDTRVELVPTKENNTGYINASHIKVSISGIGWDYIATQGPLQNTCQDFWQMVWEQGVAII
AMVTAEEEGGREKSFRYWPRLGSRHNTVTYGRFKIITRFRTDSGCYATTGLKMKHLLTGQ
ERTVWHLQYTDWPEHGCPEDIKGFLSYLEEIQSVRRHTNSTSEPENLNPPLLVHCSAGVG
RTGVVILSEIMIACLEHNETLDVPRMLDSLRQQRMMMVQTLCQYTFVYRVLVQFLRSSRL
I
Download sequence
Identical sequences ENSEEUP00000004190 ENSEEUP00000004190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]