SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004202 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004202
Domain Number 1 Region: 577-704
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-17
Family Phosphotyrosine-binding domain (PTB) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004202   Gene: ENSEEUG00000004608   Transcript: ENSEEUT00000004616
Sequence length 706
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_129:1433:5348:1 gene:ENSEEUG00000004608 transcript:ENSEEUT00000004616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSLSLGRSEQPHPICSFQDDFQEFEMIDDNEEEEEEDDDEEEEEEEGEGESKEGGGKKVP
VLDALIPSPSQEEPHKHRPTTLQLTTLGAQDSLNNNEGFAPAPPASWQETVPSSPTQEPT
REPPALLPPAPAEESPCGAQSPEHPGCDCEGNGPAGPPAPDGTSPSSDPGIEADLGSRSS
GGRGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSSGRSSHLTNSI
EEASSPASEPEPEPPCEPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNLV
SRMISEGSSPIRCPGQCLSPAQRPGEPTSPAGPGQHDHAAAGPGDVELLDMETLCGSPPP
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYA
HAVPGPAKDLLGSKRSPCWVDRFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLR
PPASCDLEISLRGVKLSLSGGPEFQHCSHFFQMKNISFCGCHPRNS
Download sequence
Identical sequences ENSEEUP00000004202 ENSEEUP00000004202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]