SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004221 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004221
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily EF-hand 2.23e-26
Family Calmodulin-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004221   Gene: ENSEEUG00000004647   Transcript: ENSEEUT00000004635
Sequence length 170
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7184:55604:105128:-1 gene:ENSEEUG00000004647 transcript:ENSEEUT00000004635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQCLRHQMHWEDLEEYQALTFLTRNEILSIHDTFLKLCPPGKCYKEVTLTMDQVSSLPA
LRVNPFRDRICRVFSHNNVLSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDED
DLHRIVLRLLNSDDVSEDLLADVTRHVLSESDLDNDNMLSFSEFEHAMAK
Download sequence
Identical sequences ENSEEUP00000004221 ENSEEUP00000004221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]