SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004309 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004309
Domain Number 1 Region: 4-304
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.57e-58
Family Mitochondrial carrier 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004309   Gene: ENSEEUG00000004745   Transcript: ENSEEUT00000004730
Sequence length 310
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2440:5283:35591:1 gene:ENSEEUG00000004745 transcript:ENSEEUT00000004730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRDTLVHLFAGGCGGTVGAVLTCPLEVVKTRLQSSSVTLYISEVQLNAMAGASVNRIV
SPGPLHCLKVILEKEGPRSLFRGLGPNIVGVAPSRAIYFAAYSNCKEKLNGVFDPDSTQV
HMISAAMAXXXXXXXXXXXXXXXXXXXXXXXNRGERRMGAFECVSKVYHTDGLKGFYRGM
SASYAGISETVIHFVIYESIKQRLLEYKTASTMESDDESVKEASDFVGMMLAAATSKTCA
TTIAYPHVVRTRLREEGTKYRSFFQTLSLVVQEEGYGSLYRGLTTHLVRQIPNTAIMMAT
YELVVYLLNG
Download sequence
Identical sequences ENSEEUP00000004309 ENSEEUP00000004309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]