SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004344 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004344
Domain Number 1 Region: 41-162
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-19
Family DBL homology domain (DH-domain) 0.0035
Further Details:      
 
Domain Number 2 Region: 262-326
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000541
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004344   Gene: ENSEEUG00000004766   Transcript: ENSEEUT00000004767
Sequence length 343
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4093:1277:5278:-1 gene:ENSEEUG00000004766 transcript:ENSEEUT00000004767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSVLHSASSRQASAVPAPQLEFESPAGCGGKCGFLSLAMGSPSRSARCPVLEQRARWERK
RACTARELLETERRYQEQLGLVATYFVGILKAKGTLRPPERQALFGPWELIYGASQELLP
YLERGHWGLGLEGFCTHLEFYTQFAANAEKSRTTLQEQLKKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXRWFLRQGWLLVVPPHGEPRPRMFFLFSDMLLVAKPRP
PLHLLQSGTFVCRALYPMAQCQLERIFGHSGGPCGGLLSVKPP
Download sequence
Identical sequences ENSEEUP00000004344 ENSEEUP00000004344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]