SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004424 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004424
Domain Number 1 Region: 138-266
Classification Level Classification E-value
Superfamily PX domain 1.01e-30
Family PX domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004424
Domain Number - Region: 350-515
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00209
Family BAR domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004424   Gene: ENSEEUG00000004840   Transcript: ENSEEUT00000004852
Sequence length 519
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8754:94340:200724:1 gene:ENSEEUG00000004840 transcript:ENSEEUT00000004852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEREPPPLGDGKPTDFEELEDGEDLFTSTVSTLESSPSSPEPASLPAEDISTNSNGPK
PAEVVLDDDREDLFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXIEEEANGDVFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSV
KRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALE
RYLQRTVKHPTLLQDLDLRQFLENSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN
ESDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSANTAAFAKSAAMLGNSEDHTAL
SRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA
QITLLKKRETEAKMMVANKPEKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEK
ERVKDFKAVIIRYLESLVQTQQQLIKYWEAFLPEAKAIA
Download sequence
Identical sequences ENSEEUP00000004424 ENSEEUP00000004424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]