SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004429 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004429
Domain Number 1 Region: 30-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.12e-40
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 556-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 523-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004429
Domain Number - Region: 330-396
Classification Level Classification E-value
Superfamily FnI-like domain 0.000795
Family VWC domain 0.091
Further Details:      
 
Domain Number - Region: 396-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 483-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0139
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004429   Gene: ENSEEUG00000004823   Transcript: ENSEEUT00000004857
Sequence length 814
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7875:52148:436574:-1 gene:ENSEEUG00000004823 transcript:ENSEEUT00000004857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESWILLRTFCLIFGLGAVWGLGVDPSLQIDILTELELGESTTGVRQVPGLHNGTKAFLF
QDAPRSIKASTVTAEQFFQKLRNKHEFTILATLKQSHLNSGVIFSIHHVDHRYLELESSG
HRNEVRLHYRTGSRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPST
DFPLGTTFWLGQRNNAHGYFKXXMQDVQLVMPQGFIVQCPDLNRTCPTCNDFHGLVQKIM
ELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWTDGCKNCTCLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICQFQGRTYFEGERNTVYSSSGVCVLYECK
DQTMKLIESSGCPTLDCPESQQITLSHSCCKVCKGYDFCSERHNCMENSVCRNLNDRAVC
SCRDGFRALREDNAYCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
HDECVTNQHNCDENALCFNTVGGHNCVXXXXXXXXXXXXXXFCRDGCRNGGACIAANVCA
CPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSLSGESCEX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQQC
RCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXNGHVCCSVDPQCLQEL
Download sequence
Identical sequences ENSEEUP00000004429 ENSEEUP00000004429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]