SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004454 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004454
Domain Number 1 Region: 91-363
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-81
Family Protein kinases, catalytic subunit 0.000000307
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-32
Family SH2 domain 0.0000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004454   Gene: ENSEEUG00000004888   Transcript: ENSEEUT00000004882
Sequence length 373
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3484:11906:17667:-1 gene:ENSEEUG00000004888 transcript:ENSEEUT00000004882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WFSGCISRSEACHRLLAEGMEQGAFLVRVSEKPGADYVLSVRDQQVVRHYKIWRRAGGQL
HLNEAVSFPSLSALVAYHQAQSLSHGLRLTTPCWKHEPEPLPHCDDWERPKEEFTLCRKL
GSGYFGEVFEGLWKDQVRVAIKVIARDDLLHQHTFRAEIQAMKKLRHKHILALYAVASIG
DPVYIITELMPKGNLLELLRDSDKQALPVSELVDIASQVAEGMCYLESQNCIHRDLAARN
ILVGDNNICKVGDFGLARLIKEDIYLSHDHNIPYKWTAPEALSRGLYSTKSDIWSFGILL
HEIFSRGQMPYPGMSNHEAFMRVDAGYRMPCRLECPPTAHKLMLSCWHRDPEQRPCFKAL
RERLCSFTRYENP
Download sequence
Identical sequences ENSEEUP00000004454 ENSEEUP00000004454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]