SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004479 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004479
Domain Number 1 Region: 203-383
Classification Level Classification E-value
Superfamily MIR domain 2.35e-48
Family MIR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1062-1152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-18
Family SPRY domain 0.044
Further Details:      
 
Domain Number 3 Region: 3803-3881
Classification Level Classification E-value
Superfamily EF-hand 0.000000048
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 4 Region: 1311-1438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000293
Family SPRY domain 0.019
Further Details:      
 
Domain Number 5 Region: 642-765
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000095
Family SPRY domain 0.068
Further Details:      
 
Domain Number 6 Region: 2038-2107
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000196
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number 7 Region: 87-168
Classification Level Classification E-value
Superfamily MIR domain 0.0000144
Family MIR domain 0.021
Further Details:      
 
Domain Number 8 Region: 414-532
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000641
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004479   Gene: ENSEEUG00000004587   Transcript: ENSEEUT00000004907
Sequence length 4767
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8982:351:588447:1 gene:ENSEEUG00000004587 transcript:ENSEEUT00000004907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDEVVLQCIANVHKEQRKFCLAAEGLGNRLCFLEPTSEAKFVPPDLCVCNFVLEQSLSVR
ALQEMLANTVENGGEGAAQGGGHRTLLYGHAILLRHSFSGMYLTCLTTSRSQTDKLAFDV
GLREQATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSVSNGNIQVDASF
MQTLWNVHPTCSGSSVEEGYLLGGHVVRLFHGHDECLTIPSTDQNDSQHRRIFYEAGGAG
TRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTEDQGLILQDRGKSDTKSTA
FCFRASKEIKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIASGLWVTYKAQDAKTSRLG
PLKRKVILHQEGHMDDGLTLQRCQCEESQAARIIRNTTALFSQFISGNNRTTAPMALPIE
EVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLSKEEGMLALVLNCIDRLNIYNS
VAHFAGLAREESGMAWKEVLSLLYKLLAALIRGNRSNCAQFSNNLDWLISKLDRLESSSG
ILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDVLCSLCLCNGVAVRANQN
LICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYRKWYFELIIDQVEPFLTAEP
THLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPRAVASINQHLLK
SDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQFLSQASFIPCPIDTS
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRDDNKRQHPCLVEFSKLPETEKN
YNLQMSTETLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSNGYKPAPLDLSDVKLLP
PQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYMLLDERTKKSNRDSL
REAVRTFVGYGYTVEPSDQELADPTVEKVSIDKIRFFRVERSYAVRSGKWYFEFEVVTGG
DMRVGWARPGCRPDIELGADDQAFVFEGSRGQRWHQGSGYFGRTWHPGDVVGCMINLDDA
SMIFTLNGELLITNKGSELAFADYEIENXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLRIDGTMDSPPCLKVTHKTFG
TQNSSASMIYCRLSMPVECHSSFSHSPCLDSDAFQKKKQLQEILSHTTTQCYYAIRIFAG
QDPSCVWVGWVTPDYHLYSEKFDLSKNCTVTVTLGDERGRVHESVKRSNCYMVWGGDIVA
TSQRSSRSNVDLEIGCLVDLAMGMLSFSANGRELGTCYQVEPNTKVFPAVFLQPTSTSLF
QFELGKLKNAMPLSAAIFKSEEKNPVPQCPPRLDVQTIQPVLWSRMPNSFLKVETEQSSE
RTGWWEQSQEPLQMMALHIPEENRCVDILELCEQEDLLQFHFHTLRLYSAVCALGNSRVA
FALCSHVDLSQLFYTIDNKYLPGLLRAGFYDLLISIHLANSKERKLMMKNEYIIPITSTT
GKIHLYPDKSKRHGLPGVGLRTCLKPGFKFSTPCFVLTGEEHQRQSPEIPLEILKTKALG
MLTEAVHCSGPHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDDDDVRQILLLIDPSVFGD
HSGETEEGAGKEEVTQEEEKAVEAGEKANKEAPVKGLLQTRLPESVKLQMCELLSYLCDC
ELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTARKTREFRSPPQEQINML
LNFQLGENCPCPDEIRGELYDFHEDLLIHCGVPLEEEEEVVEDTSWTGKLRTLVYKIKGP
PRPEKEQPTEEEEKRCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXTISQASVRDTIHLLAALGQIRCLLSVRMGKEEELLMINGLGDIMNNKVFYQH
PNLMRVLGMHETVMEVMVNVLGAEKSQIAFPKMVASCCRFLCYFCRISRQNQKAMFEHLS
YLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLEKVVTYLAGCGLQSCAM
LLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIRRPECFGPALREGG
NGLLAAMQGAIKISENPALDLPSQGYKREVSKDNGEEEEEIVHMGNAIMSFYSALIDLLG
RCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPSLNKDGSVSEPDMAANF
CPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFSLPEKLEFIVTKYAEHSHDKWACDKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEKEIYRWPARESLKTMLAMGWTVERTKEGEALVQQRENEKLRSVSQASQGNSYS
PAPLDLSNVVLSRELQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGTKDLELDASSMEKRFAYKFLKKILKYVDSAQEFIAH
LEAIVSSGKTERSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSSPLKPLSSSGYASHKEK
EMVASLFCKLAALVRHRISLFGNDSTTMVSCLHILAQTLDTRTVMKSGSELMKAGLRAFF
ENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVAQHQFGVDL
LLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLTAAIPVAFLEPGLNCYNPL
SVFNTKTSRERSILGMPTVEETCPDVPRWKGQKRRKNXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNW
LKSPDADSDQLFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKVMI
SVSGGQDQERKKTKRRGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKARYSYR
DTDEEVKEHLRNNLHLQEKSDDPAVKWQLNLYKDVLKSEEPSSPEKTVERVQRISAAVFH
LEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPHRSINLFLHGYQRFWIETGE
YSSEKKLMKNAKSPKVEEEEEEEEMEKQPDPLHQIILHFSRNALTERSKLEDDPLYTSYS
SMMAKSCQGGEEEEDEEDKEKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEM
SPMVIETLKLGIAILIGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQN
KAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTT
TVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQG
PCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLL
EGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDSKGIISKK
EFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYIDFVDQFHEPAKDIGFNVAVLLTNLS
EHMPNDSRLKCLLGPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVK
ESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISETDLADRPEEEEEDEVSSY
TLDIEGEEEDNTSFEPISAFAMACISIKRNVTHFLKKATLKNLRKQYRKVKKMSVRELVK
EFFSFFWMLFVGLFQLFFTILGGIFQILWSTVFGGGLVEGAKNIRVTKILGDMPDPTQFG
IHDDAMEVERAEVTEPGITTELVHFVKGQKGDAEIMSDLFGFHSKKEGGLKHGPEVGLGD
LSEIIGKDEPPTLESTVQKKRKAQAAEMKAAHETEGKVESEKADMEDGEKENCAKEEKQA
AALWAEAVKKKKRRRGQKVEKPEALMANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAF
AINFILLFYKVTEEPLEEETEDVANLWNSFNDEDEEEAMVFFVLQESTGYMAPALRALAI
IHTVISLVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINT
PSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLS
SIDMKYHVWKLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSS
VTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYV
GVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAGELRDQQEQV
REDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYV
WKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences ENSEEUP00000004479 ENSEEUP00000004479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]