SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004482 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004482
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily EF-hand 2.26e-19
Family S100 proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004482   Gene: ENSEEUG00000004883   Transcript: ENSEEUT00000004910
Sequence length 1629
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8437:999:77740:-1 gene:ENSEEUG00000004883 transcript:ENSEEUT00000004910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHLLQSIVTVIDIFYQYSSQDGKCDMLKRGELKELIQNEFRQILKNPDDPDTVDIIMQS
LDRDHNKKVDFIEYLLMVFKLAQACNRIISKDYCQASGSTQKDHRNWHQEEQSETEEENK
QGRSSTHSSWSAGENDSYSRSPRRSTKLRSGYGSSFLNRERESSAGSQSESYEEQGYNSS
SSETSVYGKHKSSQSPSQRRHGSYLSGQSGSNSDKHNSESSQSSGSGEYGSESGQSINQG
KSKKCPCQSSSHGKYGSSSRQQSGSYESGSGKHSNRGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGQSQWLDQYGSRLGQSSSYS
QHSSSQSSSHRHYRSGSGQSGGSGQYGSGFGHSTSYGQHGSSQSSTRGHHGYGSGQSSSH
GQCGSSSGQSSNCSQHGSGSGQYGSVSGQSSSYGSSQSSRHRRHGSGSGQSPSYGQQSSS
HSSSHRHHRSGSGQSSGSGRYGYGSGQSSGYSQQSSNQSSSHRHHGYGSGQSSSCGQHGS
SSGQSSSCGQHGSGSRQYGSGSGQSSSYGQHGSSQSSTHGHHGYGSGQSSGSGQYGSGSG
QSSSYGQQGSSQSSSHRHHGSSLGQSSSGGQYGSSSGQSSSWGQHESGLGQSSGSGQYGS
GSGQSSSYGQQGSSQSSSHGRHGSTSHQSSSYGQHESSLGHSSSYGQHGSGSGQSSGSGQ
YGSGSGQPSSYGQQSSSHSSSHRHHGSGSSQPSSCGQHGSSSGQSSSCGQHGSGSGQYSG
SGQYGSGSGQSSSYGQHGSSQSSTHEHPVSGSGQSSGSGQYGSGSGQSSSYGQQGSSQSS
GHRHRGSSLGQSSSGGQYGSSSGQSSSWGQHESGLGQSSGSGQYGSGSGQSSSYGQQGSX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQYSGYEQCGSRSQE
CRSGCDSNYDHLGFGFGQSVSNSSFERGKQHDYCYQKEGNYRGESTNSRSHGFLSSTPLY
EYFQEQRYF
Download sequence
Identical sequences ENSEEUP00000004482 ENSEEUP00000004482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]