SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004507 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004507
Domain Number 1 Region: 310-654
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.57e-115
Family Rap/Ran-GAP 0.000000601
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004507
Domain Number - Region: 690-773
Classification Level Classification E-value
Superfamily PH domain-like 0.0137
Family Third domain of FERM 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004507   Gene: ENSEEUG00000004900   Transcript: ENSEEUT00000004937
Sequence length 1632
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8395:11239:240607:1 gene:ENSEEUG00000004900 transcript:ENSEEUT00000004937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIRQRSNSDITISELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKG
YKEDRSDRGPTPTKLSDFLIAGGAKGSGFSLDVIDGPISQRGLFKEREKPLKRRSKSETG
DSSIFRKLRNAKGEELGKSSSDLEDNRSEDSVRPWTCPKCFAHYDVQSMLFDLNEAILNR
HNVIKRRNTTTGASAAAVASLVSGPLSHSASFSSPMGSTEDLNSKGSLSMDQGDDKSNEL
VLSCPYFRNEIGGEGERKISLSKSNSGSFSGCESASFESALTSHCTNAGVAVLEVPRENL
VLHLDRIKRYIVEHVDLGAYYYRKFFYQKEHWNYFGADENLGPVAVSIRREKPEEMKENG
SPYNYRIIFRTSELMTLRVSVLEDAIPSTAKHSTARGLPLKEVIEHVMPELNVHCLRLAF
NTPKVTEQLMKLDEQGLNFQQKVGVMYCKSGQSTEEEMYNNESAGPAFEDFLQLLGERVR
LKGFDKYRAQLDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQLLRKRHIGNDI
VTVVFQEPGAQPFSPKNIRSHFQHVFVVVRVHNPCTDSVCYSVAVTRSRDVPSFGPPIPK
GVTFPKSNVFRDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSG
KFPFISLASKKKEKSKPYPGAELSSMGAIVWTVRAKDYNKAMEIDCLLGISNEFIILIEQ
ETKSVVFNCSCRDVIGWTSTDTSLKIFYERGECVSVESLLTSEDIKEIVRRLQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSCSETYRLPVMEYKMDEGVSYEFKFPFRNNNKWQR
NASKGAQSTQVPGQVQSPMPSRLNAGKGDGKMPPPERANIPRSISSDGRPLERRXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGVSRRSPASIDRQNTQ
PDFAGSAKSTPSWQRSEDSIANQMAYSYRGPQDFNSFVEQHDYTEPTCHLPAVSKVLPAF
RESPSGRLMRQDPVVHLSPNKQGHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXRHQSDSNEMAHTRLRTSTRDLRASPKPTAKSTIEENLKKLIDLESPTS
ESQKNFKFHALSSPQSPFPTTPTSRRALHRTLSDESIYSGQREHFFTSRASLLDQALPND
VLFSSTYPSLPKSLPLRRPSYTLGMKPLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXQRASFFAASDGNHRPLSAASNSDQLEDQALAQMKPYSSSKD
SSPTLASKVDQLEGMLKLLREDLKKEKEDKAHLQAEVQHLREDNLRLQEESQNASDRLKK
FTEWVFNTIDMS
Download sequence
Identical sequences ENSEEUP00000004507 ENSEEUP00000004507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]