SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004598 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004598
Domain Number 1 Region: 382-548
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-34
Family Phosphotyrosine-binding domain (PTB) 0.025
Further Details:      
 
Domain Number 2 Region: 572-637
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000875
Family Phosphotyrosine-binding domain (PTB) 0.0000717
Further Details:      
 
Domain Number 3 Region: 286-311
Classification Level Classification E-value
Superfamily WW domain 0.000000000163
Family WW domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004598   Gene: ENSEEUG00000005037   Transcript: ENSEEUT00000005034
Sequence length 640
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6076:1008:157033:-1 gene:ENSEEUG00000005037 transcript:ENSEEUT00000005034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PADPGADSLAVFMASSGTTDVANRNSPATPPNTLNLRSSHNELLNAEIKHTEAKNSTPPK
CRKKYALTNIQAAMGLSDPATQPLLGNSSANIKLVKNGENQLRKAAEQGQQDPNKNISPT
GVINITSEKLEGKEPHPRESLGCDILPSQPRRTKSFLNYYADLETSARDVEQSLGNHQEA
VEEKSQANQDQASTILGNGDLLLQKPNKPQFSPEDGQVATVSSSPETKKDHPKTGAKTDC
ALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHTFQTDPDLPPGWKKVNDVAGT
YYWHIPTGTTQWERPVSIPPDLQGSRKGSLSSVTPSPTPENEKQPWSDFAVLNGGKINSD
IWKANDLHAATVNPDPSLKEFEGATLRYASLKLRNVPQAEDDDSCSINSDPEAKCFAVRS
LGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDTLSLVD
PMDRTALHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHE
ICSKIMAERKNAKALACSSLQERTNVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPVDKP
VGMDTLNNAIENLMTSSDKEDWPSVNMNVADATVTVISEK
Download sequence
Identical sequences ENSEEUP00000004598 ENSEEUP00000004598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]